1. Recombinant Proteins
  2. Others
  3. NUDC Protein, Human (HEK293, His)

NUDC Protein, Human (HEK293, His)

Cat. No.: HY-P75947
COA Handling Instructions

NUDC protein is essential for neurogenesis and neuronal migration, contributing to the correct formation of mitotic spindles and chromosome separation during mitosis. It plays a crucial role in cytokinesis and cell proliferation. NUDC interacts with PAFAH1B1, forms a complex with PLK1, dynein, and dynactin, and interacts with DCDC1 and EML4, emphasizing its multifaceted involvement in various cellular processes. NUDC Protein, Human (HEK293, His) is the recombinant human-derived NUDC protein, expressed by HEK293 , with C-His labeled tag. The total length of NUDC Protein, Human (HEK293, His) is 331 a.a., with molecular weight of ~39.7 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $75 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NUDC protein is essential for neurogenesis and neuronal migration, contributing to the correct formation of mitotic spindles and chromosome separation during mitosis. It plays a crucial role in cytokinesis and cell proliferation. NUDC interacts with PAFAH1B1, forms a complex with PLK1, dynein, and dynactin, and interacts with DCDC1 and EML4, emphasizing its multifaceted involvement in various cellular processes. NUDC Protein, Human (HEK293, His) is the recombinant human-derived NUDC protein, expressed by HEK293 , with C-His labeled tag. The total length of NUDC Protein, Human (HEK293, His) is 331 a.a., with molecular weight of ~39.7 kDa.

Background

NUDC protein plays a crucial role in neurogenesis and neuronal migration. It is essential for the proper formation of mitotic spindles, accurate chromosome separation during mitosis, cytokinesis, and cell proliferation. NUDC interacts with key proteins such as PAFAH1B1, PLK1, DCDC1, and forms a complex with dynein and dynactin. Additionally, its interaction with EML4, specifically through the WD repeats, further emphasizes its involvement in cellular processes crucial for neurodevelopment and cell division.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q9Y266 (M1-N331)

Gene ID
Molecular Construction
N-term
NUDC (M1-N331)
Accession # Q9Y266
His
C-term
Synonyms
Nuclear migration protein nudC; Nuclear distribution protein C homolog; NUDC
AA Sequence

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

Molecular Weight

Approximately 43-50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCL, 500 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NUDC Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NUDC Protein, Human (HEK293, His)
Cat. No.:
HY-P75947
Quantity:
MCE Japan Authorized Agent: