Odorant receptor Protein, Larimichthys crocea (Cell-Free, His)

Odorant receptor proteins are part of the insect chemoreceptor superfamily within the heteromeric odorant receptor channel family and play a key role in the complex chemoreceptor network for insect olfactory perception. As a member of this superfamily, odorant receptors may be critical for detecting and responding to different odorant stimuli. Odorant receptor Protein, Larimichthys crocea (Cell-Free, His) is the recombinant Odorant receptor protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of Odorant receptor Protein, Larimichthys crocea (Cell-Free, His) is 308 a.a., with molecular weight of 37.0 kDa.

The Odorant receptor protein belongs to the insect chemoreceptor superfamily and is specifically categorized within the Heteromeric Odorant Receptor Channel (TC 1.A.69) family. This classification underscores its role as a key component in the intricate network of chemoreceptors employed by insects for olfactory perception. As a member of the insect chemoreceptor superfamily, the Odorant receptor is likely integral to the process of detecting and responding to diverse odor stimuli. Further investigation is essential to unravel the specific functions and implications of Odorant receptors within the broader framework of the Heteromeric Odorant Receptor Channel family, shedding light on their significance in the sensory biology of insects.

Others

E. coli Cell-free

N-10*His

F2XEX3 (M1-I308)

/

MMDNVSKLTIFTLSGLHEIANYRVTLFVLTLLCYCVIWLINLAIIVTIIMDKSLHEPMYIFLCNLCINGLYETAGFYPKFLIDLLSTFHVISYAGCLLQGFVLHSSACADFSILVLMAYDRYVAICRPLVYHSVMTTQRVCVFIFFAWLIPLYLVFMSSITTARSRLCGSHIPKIYCINFLVGKLACTTSIANVIIPAFNYTFYFLHVMFIAWSYMYLIRKCLISSENRSKFMQTCLPHLICLIIVVVSLLFDLLYMRFGSQTLSQNVKNFMAMEFLLVPPIINPLIYGFKLTQIRNRIIQFLSGKRI

37.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.