Oleosin L Protein, Sesamum indicum (Cell-Free, His)
The oleosin L protein plays a structural role in stabilizing liposomes during seed drying, preventing oil coalescence and affecting liposome integrity. Its potential interactions with lipid and phospholipid moieties suggest the involvement of multiple molecules. Oleosin L Protein, Sesamum indicum (Cell-Free, His) is the recombinant Oleosin L protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Others
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The oleosin L protein plays a structural role in stabilizing liposomes during seed drying, preventing oil coalescence and affecting liposome integrity. Its potential interactions with lipid and phospholipid moieties suggest the involvement of multiple molecules. Oleosin L Protein, Sesamum indicum (Cell-Free, His) is the recombinant Oleosin L protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Background
The Oleosin L protein appears to serve a structural role in stabilizing lipid bodies during seed desiccation by preventing the coalescence of oil, highlighting its importance in seed physiology. Its potential interaction with both lipid and phospholipid moieties of lipid bodies suggests a versatile molecular engagement, possibly influencing the lipid body's integrity and function. Furthermore, Oleosin L may play a role in providing recognition signals for specific lipase anchorage, indicating its involvement in lipolysis during seedling growth. The multifaceted functions attributed to Oleosin L underscore its significance in orchestrating essential processes related to lipid metabolism and seed development.
Technical Parameters
-
Species Others
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q9XHP2 (M1-S145)
-
Gene ID/
-
Molecular Construction
-
N-term
-
10*His
-
Oleosin L (M1-S145)
Accession # Q9XHP2 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Oleosin L; Allergen Ses i 5; Oleosin 15 kDa; Ses i 5.0101
-
AA Sequence
MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS
-
Predicted Molecular Mass
16.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
