OPN3 Protein, Human (Cell-Free, His)

OPN3 protein is a UV-sensitive G protein-coupled receptor that regulates melanogenesis in melanocytes by inhibiting α-MSH-induced cAMP signaling and regulating calcium flux following UVA light activation. OPN3 is critical for melanocyte survival, regulating intracellular calcium levels, affecting BCL2/RAF1 signaling and apoptosis through caspase cascade activation. OPN3 Protein, Human (Cell-Free, His) is the recombinant human-derived OPN3 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of OPN3 Protein, Human (Cell-Free, His) is 402 a.a., with molecular weight of 47.7 kDa.

The OPN3 Protein, a G-protein coupled receptor, selectively activates G proteins via ultraviolet A (UVA) light-mediated activation in the skin. It binds both 11-cis retinal and all-trans retinal, regulating melanogenesis in melanocytes by inhibiting alpha-MSH-induced MC1R-mediated cAMP signaling and modulating calcium flux. OPN3 plays a crucial role in melanocyte survival through the regulation of intracellular calcium levels and subsequent BCL2/RAF1 signaling, while also influencing apoptosis via cytochrome c release and activation of the caspase cascade. In addition to being required for TYR and DCT blue light-induced complex formation in melanocytes, OPN3 is involved in keratinocyte differentiation and the UVA-mediated induction of calcium and mitogen-activated protein kinase signaling in dermal fibroblasts. It plays a role in light-mediated glucose uptake, mitochondrial respiration, and fatty acid metabolism in brown adipocyte tissues. Furthermore, OPN3 may contribute to the photorelaxation of airway smooth muscle cells through blue-light dependent GPCR signaling pathways. Its interaction with MC1R results in a decrease in MC1R-mediated cAMP signaling, ultimately reducing melanin production in melanocytes.

Human

E. coli Cell-free

N-10*His

Q9H1Y3 (M1-L402)

23596

MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL

47.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.