P2RY1 Protein, Mouse (Cell-Free, His)

The P2RY1 Protein serves as a receptor for extracellular adenine nucleotides, particularly ADP. In platelets, ADP binding to P2RY1 triggers intracellular calcium mobilization through phospholipase C activation, inducing platelet shape changes and culminating in platelet aggregation. P2RY1 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived P2RY1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of P2RY1 Protein, Mouse (Cell-Free, His) is 373 a.a., with molecular weight of 48.3 kDa.

The P2RY1 receptor functions as a receptor for extracellular adenine nucleotides, notably ADP. In platelets, its binding to ADP initiates the mobilization of intracellular calcium ions through the activation of phospholipase C, resulting in a change in platelet shape and ultimately facilitating platelet aggregation.

Mouse

E. coli Cell-free

N-10*His

P49650 (M1-L373)

18441

MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVVVAISPILFYSGTGTRKNKTVTCYDTTSNDYLRSYFIYSMCTTVAMFCIPLVLILGCYGLIVKALIYNDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEEMTLNILSEFKQNGDTSL

48.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.