Copy Link Print Information

PAFAHB Protein, Human (His)

PAFAHB Proteinas, incorporating Alpha-2 adrenergic receptors, facilitates catecholamine-induced adenylate cyclase inhibition through G proteins. Notably, oxymetazoline ranks as the most potent agonist, followed by clonidine and antagonists with yohimbine exhibiting the highest inhibitory activity. This insight into agonist and antagonist effectiveness sheds light on the pharmacological modulation of Alpha-2 adrenergic receptors by ADRA2A-VLPs. PAFAHB Protein, Human (His) is the recombinant human-derived PAFAHB protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for PAFAHB Protein, Human (His)
  • PAFAHB Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PAFAHB Proteinas, incorporating Alpha-2 adrenergic receptors, facilitates catecholamine-induced adenylate cyclase inhibition through G proteins. Notably, oxymetazoline ranks as the most potent agonist, followed by clonidine and antagonists with yohimbine exhibiting the highest inhibitory activity. This insight into agonist and antagonist effectiveness sheds light on the pharmacological modulation of Alpha-2 adrenergic receptors by ADRA2A-VLPs. PAFAHB Protein, Human (His) is the recombinant human-derived PAFAHB protein, expressed by E. coli , with C-6*His labeled tag.

Background

ADRA2A-VLPs, as a construct incorporating Alpha-2 adrenergic receptors, facilitate the catecholamine-induced inhibition of adenylate cyclase via G proteins. The receptor exhibits distinct agonist and antagonist pharmacological profiles. Among agonists, oxymetazoline demonstrates the highest potency, followed by clonidine, epinephrine, norepinephrine, phenylephrine, dopamine, p-synephrine, p-tyramine, serotonin, and p-octopamine. Conversely, antagonists show varying degrees of inhibitory activity, with yohimbine ranking as the most potent, followed by phentolamine, mianserine, chlorpromazine, spiperone, prazosin, propranolol, alprenolol, and pindolol. This delineation of agonist and antagonist effectiveness provides valuable insights into the pharmacological modulation of Alpha-2 adrenergic receptors mediated by ADRA2A-VLPs.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P68402 (S2-A229)

  • Gene ID
    5049  [NCBI]
  • Molecular Construction
    • N-term
    • PAFAHB (S2-A229)
      Accession # P68402
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PAFAH1B2; Platelet-Activating Factor Acetylhydrolase, Isoform Ib, Beta Subunit 30kDa; Platelet Activating Factor Acetylhydrolase 1b Catalytic Subunit 2; Platelet-Activating Factor Acetylhydrolase, Isoform Ib, Subunit 2 (30kDa); Platelet-Activating Factor

  • AA Sequence

    SQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

  • Predicted Molecular Mass

    26.6 kDa

  • Molecular Weight

    Approximately 31 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • PAFAHB Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for PAFAHB Protein, Human (His)
  • PAFAHB Protein, Human (His) Product Image