PDCD10 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.

Background

PDCD10 Protein emerges as a multifunctional regulator, exerting its influence on diverse cellular processes. Notably, it plays a pivotal role in promoting cell proliferation, modulating apoptotic pathways, and enhancing mitogen-activated protein kinase activity and STK26 activity. Beyond its involvement in cell cycle dynamics, PDCD10 is essential for cell migration, contributing to the normal structure and assembly of the Golgi complex. Furthermore, it proves critical for KDR/VEGFR2 signaling by increasing the stability of KDR/VEGFR2 and preventing its breakdown. PDCD10's significance extends to embryonic development, where it is required for normal cardiovascular development, angiogenesis, vasculogenesis, and hematopoiesis. Operating as a homodimer, PDCD10 engages in a network of protein-protein interactions, including associations with CCM2, PXN, STK25, STK26, STK24, GOLGA2, and KDR/VEGFR2, highlighting its intricate involvement in cellular signaling pathways and structural processes. The intricate interplay of PDCD10 in these molecular networks underscores its versatile role in cellular homeostasis and warrants further investigation to unravel the detailed mechanisms governing its diverse functions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PDCD10 (M1-Al212 )
      Accession # Q9BUL8
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PDCD10; TF-1 Cell Apoptosis-Related Protein 15; Prev. CCM3; Cerebral Cavernous Malformations 3; TFAR15; Apoptosis-Related Protein 15; Cerebral Cavernous Malformations 3 Protein; Programmed Cell Death 10; Programmed Cell Death Protein 10

  • AA Sequence

    MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

  • Predicted Molecular Mass

    24.9 kDa

  • Molecular Weight

    Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00