PDCD10 Protein, Human
Based on 1 publication(s) in Google Scholar
The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The PDCD10 protein is a multifunctional regulator that plays a key role in cell proliferation, apoptosis regulation, and enhanced kinase activity. It is essential for cell migration, Golgi complex assembly and KDR/VEGFR2 signaling stability, affecting embryonic development, cardiovascular development, vasculogenesis, vasculogenesis and hematopoiesis. PDCD10 Protein, Human is the recombinant human-derived PDCD10 protein, expressed by E. coli , with tag free.
PDCD10 Protein emerges as a multifunctional regulator, exerting its influence on diverse cellular processes. Notably, it plays a pivotal role in promoting cell proliferation, modulating apoptotic pathways, and enhancing mitogen-activated protein kinase activity and STK26 activity. Beyond its involvement in cell cycle dynamics, PDCD10 is essential for cell migration, contributing to the normal structure and assembly of the Golgi complex. Furthermore, it proves critical for KDR/VEGFR2 signaling by increasing the stability of KDR/VEGFR2 and preventing its breakdown. PDCD10's significance extends to embryonic development, where it is required for normal cardiovascular development, angiogenesis, vasculogenesis, and hematopoiesis. Operating as a homodimer, PDCD10 engages in a network of protein-protein interactions, including associations with CCM2, PXN, STK25, STK26, STK24, GOLGA2, and KDR/VEGFR2, highlighting its intricate involvement in cellular signaling pathways and structural processes. The intricate interplay of PDCD10 in these molecular networks underscores its versatile role in cellular homeostasis and warrants further investigation to unravel the detailed mechanisms governing its diverse functions.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Virol
FMDV 3A cooperates with PDCD10 to promote FMDV replication by inhibiting VISA-mediated innate immunity. [Abstract]2025 Nov 26:e0065725. PMID: 41296880
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9BUL8 (M1-Al212 )
-
Molecular Construction
-
N-term
-
PDCD10 (M1-Al212 )
Accession # Q9BUL8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PDCD10; TF-1 Cell Apoptosis-Related Protein 15; Prev. CCM3; Cerebral Cavernous Malformations 3; TFAR15; Apoptosis-Related Protein 15; Cerebral Cavernous Malformations 3 Protein; Programmed Cell Death 10; Programmed Cell Death Protein 10
-
AA Sequence
MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
-
Predicted Molecular Mass
24.9 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)