PEDF Protein, Human (His)

PEDF Protein, Human is a secreted glycoprotein and a non-inhibitory member of the serine protease inhibitor (serpin) family.

Pigment Epithelium-derived Factor belongs to the serine protease inhibitor (serpin) family. The Pigment Epithelium-derived Factor gene contains a typical signalpeptide sequence, initiator methionine codon, and polyadenylylation signal and matches the size of other members of the serpin superfamily. Pigment Epithelium-derived Factor is a neurotrophic agent^[1]. It is widely expressed in human fetal and adult tissues but its expression decreases with age and in malignant tissues. The main anticancer activities of Pigment Epithelium-derived Factor derive from its dual effects, either indirectly on the tumor microenvironment (indirect antitumor action) or directly on the tumor itself (direct antitumor influence)^[2]. Pigment Epithelium-derived Factor has complex neurotrophic, neuroprotective, anti-angiogenic, anti-oxidative, and anti-inflammatory properties, and could potentially be exploited as a therapeutic option for the treatment of vascular complications in diabete

Human

E. coli

N-6*His

P36955 (Q20-P418)

5176  [NCBI]

QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Approximately 45.36 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.