Peroxiredoxin-2/PRDX2 Protein, Human (His)
Peroxiredoxin-2 (PRDX2) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides, which is essential for cellular protection against oxidative stress. It detoxifies peroxide, senses hydrogen peroxide-mediated signaling events, and may participate in signaling cascades initiated by growth factors and tumor necrosis factor-alpha. Peroxiredoxin-2/PRDX2 Protein, Human (His) is the recombinant human-derived Peroxiredoxin-2/PRDX2 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Peroxiredoxin-2 (PRDX2) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides, which is essential for cellular protection against oxidative stress. It detoxifies peroxide, senses hydrogen peroxide-mediated signaling events, and may participate in signaling cascades initiated by growth factors and tumor necrosis factor-alpha. Peroxiredoxin-2/PRDX2 Protein, Human (His) is the recombinant human-derived Peroxiredoxin-2/PRDX2 protein, expressed by E. coli , with N-His labeled tag.
Background
Peroxiredoxin-2 (PRDX2), a thiol-specific peroxidase, serves as a catalyst in the reduction of hydrogen peroxide and organic hydroperoxides, converting them into water and alcohols, respectively. Its vital role in cellular protection against oxidative stress involves detoxifying peroxides and acting as a sensor for hydrogen peroxide-mediated signaling events. PRDX2 may also participate in the signaling cascades initiated by growth factors and tumor necrosis factor-alpha, potentially influencing intracellular concentrations of H(2)O(2). This versatile protein underscores its significance in cellular redox regulation and stress response pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P32119-1 (A2-N198)
-
Molecular Construction
-
N-term
-
His
-
PRDX2 (A2-N198)
Accession # P32119-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PRDX2; Natural Killer Cell-Enhancing Factor B; Prev. TDPX1; MGC4104; NKEFB; NKEF-B; PRP; Torin; TSA; Epididymis Secretory Sperm Binding Protein Li 2a; Thioredoxin-Dependent Peroxide Reductase 1; Thiol-Specific Antioxidant Protein; Thioredoxin-Dependent Pe
-
AA Sequence
ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
-
Predicted Molecular Mass
25.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
