Peroxiredoxin-2/PRDX2 Protein, Human (His)

Peroxiredoxin-2 (PRDX2) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides, which is essential for cellular protection against oxidative stress. It detoxifies peroxide, senses hydrogen peroxide-mediated signaling events, and may participate in signaling cascades initiated by growth factors and tumor necrosis factor-alpha. Peroxiredoxin-2/PRDX2 Protein, Human (His) is the recombinant human-derived Peroxiredoxin-2/PRDX2 protein, expressed by E. coli , with N-His labeled tag. The total length of Peroxiredoxin-2/PRDX2 Protein, Human (His) is 197 a.a., with molecular weight of ~25.8 kDa.

Peroxiredoxin-2 (PRDX2), a thiol-specific peroxidase, serves as a catalyst in the reduction of hydrogen peroxide and organic hydroperoxides, converting them into water and alcohols, respectively. Its vital role in cellular protection against oxidative stress involves detoxifying peroxides and acting as a sensor for hydrogen peroxide-mediated signaling events. PRDX2 may also participate in the signaling cascades initiated by growth factors and tumor necrosis factor-alpha, potentially influencing intracellular concentrations of H(2)O(2). This versatile protein underscores its significance in cellular redox regulation and stress response pathways.

Human

E. coli

N-His

P32119 (2A-198N)

7001  [NCBI]

ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Approximately 25.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.