PFDN1 Protein, Mouse (His)
Based on 1 Customer Validation
The PFDN1 protein is a key player in the immune response, presenting antigen to CD4 T cells by accommodating 10-30 residue peptides in its peptide-binding cleft. PFDN1 plays a role in the endocytic pathway of antigen-presenting cells, specifically in the exogenous antigen presentation pathway, forming heteromers with three MHC class II molecules and a CD74 trimer in the endoplasmic reticulum. PFDN1 Protein, Mouse (His) is the recombinant mouse-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The PFDN1 protein is a key player in the immune response, presenting antigen to CD4 T cells by accommodating 10-30 residue peptides in its peptide-binding cleft. PFDN1 plays a role in the endocytic pathway of antigen-presenting cells, specifically in the exogenous antigen presentation pathway, forming heteromers with three MHC class II molecules and a CD74 trimer in the endoplasmic reticulum. PFDN1 Protein, Mouse (His) is the recombinant mouse-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.
Background
HLA-DPB1, a pivotal player in the immune response, is instrumental in presenting peptides derived from antigens to CD4 T-cells. Operating within the endocytic route of antigen-presenting cells (APCs), HLA-DPB1's peptide binding cleft accommodates a range of 10-30 residue peptides. This MHC class II molecule is particularly involved in the exogenous antigen presentation pathway, where peptides from degraded proteins are presented on the cell surface. The complex process involves the association of three MHC class II molecules with a CD74 trimer in the endoplasmic reticulum (ER), forming a heterononamer. Upon entry into the endosomal/lysosomal system, CD74 undergoes sequential degradation, culminating in the release of a small fragment known as CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM, which stabilizes MHC class II molecules until high-affinity antigenic peptides are bound. The resultant MHC II molecule-peptide complex is then transported to the cell membrane surface for recognition. Notably, HLA-DO in B-cells and primary dendritic cells (DCs) regulate the interaction between HLA-DM and MHC class II molecules. The lysosomal microenvironment, characterized by increased acidification, plays a crucial role in regulating antigen loading into MHC II molecules, impacting proteolysis and efficient peptide loading. The heterodimeric structure of HLA-DPB1, composed of an alpha and a beta subunit, contributes to its multifaceted role in antigen presentation.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9CQF7 (M1-Q122)
-
Gene ID67199 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
PFDN1 (M1-Q122)
Accession # Q9CQF7 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PFDN1; Prefoldin 1; Prefoldin Subunit 1; PDF; PFD1
-
AA Sequence
MAASVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHNQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
-
Molecular Weight
Approximately 16 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)