PFDN1 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

The PFDN1 protein is a key player in the immune response, presenting antigen to CD4 T cells by accommodating 10-30 residue peptides in its peptide-binding cleft. PFDN1 plays a role in the endocytic pathway of antigen-presenting cells, specifically in the exogenous antigen presentation pathway, forming heteromers with three MHC class II molecules and a CD74 trimer in the endoplasmic reticulum. PFDN1 Protein, Mouse (His) is the recombinant mouse-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PFDN1 protein is a key player in the immune response, presenting antigen to CD4 T cells by accommodating 10-30 residue peptides in its peptide-binding cleft. PFDN1 plays a role in the endocytic pathway of antigen-presenting cells, specifically in the exogenous antigen presentation pathway, forming heteromers with three MHC class II molecules and a CD74 trimer in the endoplasmic reticulum. PFDN1 Protein, Mouse (His) is the recombinant mouse-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.

Background

HLA-DPB1, a pivotal player in the immune response, is instrumental in presenting peptides derived from antigens to CD4 T-cells. Operating within the endocytic route of antigen-presenting cells (APCs), HLA-DPB1's peptide binding cleft accommodates a range of 10-30 residue peptides. This MHC class II molecule is particularly involved in the exogenous antigen presentation pathway, where peptides from degraded proteins are presented on the cell surface. The complex process involves the association of three MHC class II molecules with a CD74 trimer in the endoplasmic reticulum (ER), forming a heterononamer. Upon entry into the endosomal/lysosomal system, CD74 undergoes sequential degradation, culminating in the release of a small fragment known as CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM, which stabilizes MHC class II molecules until high-affinity antigenic peptides are bound. The resultant MHC II molecule-peptide complex is then transported to the cell membrane surface for recognition. Notably, HLA-DO in B-cells and primary dendritic cells (DCs) regulate the interaction between HLA-DM and MHC class II molecules. The lysosomal microenvironment, characterized by increased acidification, plays a crucial role in regulating antigen loading into MHC II molecules, impacting proteolysis and efficient peptide loading. The heterodimeric structure of HLA-DPB1, composed of an alpha and a beta subunit, contributes to its multifaceted role in antigen presentation.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • PFDN1 (M1-Q122)
      Accession # Q9CQF7
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PFDN1; Prefoldin 1; Prefoldin Subunit 1; PDF; PFD1

  • AA Sequence

    MAASVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHNQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

  • Molecular Weight

    Approximately 16 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00