1. Recombinant Proteins
  2. Others
  3. PFDN1 Protein, Human (His)

PFDN1 Protein is pivotal in protein folding, binding specifically to cytosolic chaperonin (c-CPN) and aiding the transfer of target proteins. It also binds nascent polypeptide chains, facilitating their folding amidst diverse alternative pathways. Structurally, PFDN1 forms a heterohexamer with two PFD-alpha type and four PFD-beta type subunits. PFDN1 Protein, Human (His) is the recombinant human-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PFDN1 Protein is pivotal in protein folding, binding specifically to cytosolic chaperonin (c-CPN) and aiding the transfer of target proteins. It also binds nascent polypeptide chains, facilitating their folding amidst diverse alternative pathways. Structurally, PFDN1 forms a heterohexamer with two PFD-alpha type and four PFD-beta type subunits. PFDN1 Protein, Human (His) is the recombinant human-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.

Background

PFDN1 protein plays a crucial role in protein folding as it specifically binds to cytosolic chaperonin (c-CPN) and facilitates the transfer of target proteins to it. It also binds to nascent polypeptide chains, aiding in their folding process within an environment where numerous alternative pathways for nonnative proteins exist. Structurally, PFDN1 protein forms a heterohexamer consisting of two PFD-alpha type and four PFD-beta type subunits.

Species

Human

Source

E. coli

Tag

N-His

Accession

O60925 (M1-Q122)

Gene ID

5201  [NCBI]

Molecular Construction
N-term
His
PFDN1 (M1-Q122)
Accession # O60925
C-term
Protein Length

Full Length

Synonyms
Prefoldin subunit 1; PFDN1; PFD1
AA Sequence

MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

Predicted Molecular Mass
16 kDa
Molecular Weight

Approximately 17 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PFDN1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PFDN1 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PFDN1 Protein, Human (His)
Cat. No.:
HY-P76540
Quantity:
MCE Japan Authorized Agent: