PFDN1 Protein, Human (His)
PFDN1 Protein is pivotal in protein folding, binding specifically to cytosolic chaperonin (c-CPN) and aiding the transfer of target proteins. It also binds nascent polypeptide chains, facilitating their folding amidst diverse alternative pathways. Structurally, PFDN1 forms a heterohexamer with two PFD-alpha type and four PFD-beta type subunits. PFDN1 Protein, Human (His) is the recombinant human-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PFDN1 Protein is pivotal in protein folding, binding specifically to cytosolic chaperonin (c-CPN) and aiding the transfer of target proteins. It also binds nascent polypeptide chains, facilitating their folding amidst diverse alternative pathways. Structurally, PFDN1 forms a heterohexamer with two PFD-alpha type and four PFD-beta type subunits. PFDN1 Protein, Human (His) is the recombinant human-derived PFDN1 protein, expressed by E. coli , with N-His labeled tag.
PFDN1 protein plays a crucial role in protein folding as it specifically binds to cytosolic chaperonin (c-CPN) and facilitates the transfer of target proteins to it. It also binds to nascent polypeptide chains, aiding in their folding process within an environment where numerous alternative pathways for nonnative proteins exist. Structurally, PFDN1 protein forms a heterohexamer consisting of two PFD-alpha type and four PFD-beta type subunits.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O60925 (M1-Q122)
-
Gene ID5201 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
PFDN1 (M1-Q122)
Accession # O60925 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PFDN1; Prefoldin 1; Prefoldin Subunit 1; PDF; PFD1
-
AA Sequence
MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
-
Predicted Molecular Mass
16 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
