Placental Lactogen/CSH1 Protein, Human (HEK293, His)

Placental Lactogen/CSH1 Protein, exclusive to pregnancy, orchestrates lactation, fetal growth, and metabolism. Its unique mode of action involves zinc-induced dimerization of the Prolactin Receptor (PRLR), distinct from the Growth Hormone Receptor (GHR). This specificity and structural versatility underline its pivotal role in intricate pregnancy-related processes and maternal physiology. Placental Lactogen/CSH1 Protein, Human (HEK293, His) is the recombinant human-derived Placental Lactogen/CSH1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Placental Lactogen/CSH1 Protein, Human (HEK293, His) is 191 a.a., with molecular weight of ~22-24 kDa.

Placental Lactogen/CSH1 Protein, exclusively generated during pregnancy, plays a pivotal role in orchestrating lactation, fetal growth, and metabolic processes. Remarkably, it exhibits a unique mode of action, as it does not interact with the Growth Hormone Receptor (GHR). Instead, its activation is exclusively mediated through zinc-induced dimerization of the Prolactin Receptor (PRLR). This distinctive mechanism contributes to the protein's specificity and underscores its significance in the intricate processes associated with pregnancy and maternal physiology. Notably, Placental Lactogen/CSH1 can exist in both monomeric and dimeric forms, highlighting its structural versatility.

Human

HEK293

C-6*His

P0DML2 (V27-F217)

1442  [NCBI]

VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Approximately 22-24kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.