PPIE Protein, Human (His)

The PPIE protein is a key spliceosome component that complexly regulates pre-mRNA splicing through RNA binding and PPIase activity. It prefers single-stranded RNA with polyA and polyU stretches, indicating an affinity for the poly(A) region of the 3'-UTR. PPIE Protein, Human (His) is the recombinant human-derived PPIE protein, expressed by E. coli , with N-6*His labeled tag. The total length of PPIE Protein, Human (His) is 301 a.a., with molecular weight of ~34.0 kDa.

PPIE protein plays a crucial role in pre-mRNA splicing as an integral component of the spliceosome. This multifunctional protein combines RNA-binding and peptidyl-prolyl cis-trans isomerase (PPIase) activities, contributing to the intricate process of splicing regulation. PPIE exhibits a preference for single-stranded RNA molecules with poly-A and poly-U stretches, suggesting its affinity for the poly(A)-region in the 3'-UTR of mRNA molecules. Beyond its role in RNA binding, PPIE catalyzes the cis-trans isomerization of proline imidic peptide bonds in proteins. Notably, it functions as an inhibitor of KMT2A activity, and this regulatory effect is contingent on its proline isomerase activity. The versatile functions of PPIE underscore its significance in coordinating various aspects of cellular processes, including RNA splicing and protein conformational changes.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

Q9UNP9 (M1-V301)

10450  [NCBI]

MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

Approximately 34.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.