Copy Link Print Information

PPIE Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The PPIE protein is a key spliceosome component that complexly regulates pre-mRNA splicing through RNA binding and PPIase activity. It prefers single-stranded RNA with polyA and polyU stretches, indicating an affinity for the poly(A) region of the 3'-UTR. PPIE Protein, Human (His) is the recombinant human-derived PPIE protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for PPIE Protein, Human (His)
  • PPIE Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The PPIE protein is a key spliceosome component that complexly regulates pre-mRNA splicing through RNA binding and PPIase activity. It prefers single-stranded RNA with polyA and polyU stretches, indicating an affinity for the poly(A) region of the 3'-UTR. PPIE Protein, Human (His) is the recombinant human-derived PPIE protein, expressed by E. coli , with N-6*His labeled tag.

Background

PPIE protein plays a crucial role in pre-mRNA splicing as an integral component of the spliceosome. This multifunctional protein combines RNA-binding and peptidyl-prolyl cis-trans isomerase (PPIase) activities, contributing to the intricate process of splicing regulation. PPIE exhibits a preference for single-stranded RNA molecules with poly-A and poly-U stretches, suggesting its affinity for the poly(A)-region in the 3'-UTR of mRNA molecules. Beyond its role in RNA binding, PPIE catalyzes the cis-trans isomerization of proline imidic peptide bonds in proteins. Notably, it functions as an inhibitor of KMT2A activity, and this regulatory effect is contingent on its proline isomerase activity. The versatile functions of PPIE underscore its significance in coordinating various aspects of cellular processes, including RNA splicing and protein conformational changes.

Verified Bioactivity

Measured by its ability to convert the 0.3mM substrate of Suc-AAPF-pNA, from Cis to Transformation. The specific activity is 4.156 nmol/min/μg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    Q9UNP9 (M1-V301)

  • Gene ID
    10450  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • PPIE (M1-V301)
      Accession # Q9UNP9
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PPIE; MGC111222; Peptidylprolyl Isomerase E; MGC3736; Peptidyl-Prolyl Cis-Trans Isomerase E; CYP33; Rotamase E; Peptidylprolyl Isomerase E (Cyclophilin E); PPIase E; Peptidylprolyl Isomerase E, Isoform 1; CyP-33; Peptidyl-Prolyl Cis-Trans Isomerase; CypE; Cyclophilin 33; Cyclophilin-33; PPIase; Cyclophilin E

  • AA Sequence

    MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

  • Predicted Molecular Mass

    35.6 kDa

  • Molecular Weight

    Approximately 33-38 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • PPIE Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for PPIE Protein, Human (His)
  • PPIE Protein, Human (His) Product Image