PRKG1 Protein, Human (HEK293, His)

PRKG1, a serine/threonine protein kinase, mediates the NO/csignaling pathway, phosphorylating various cellular proteins. It influences platelet activation, smooth muscle contraction, cardiac function, CNS processes, and more. PRKG1 regulates intracellular calcium levels, inhibits IP3-induced Ca(2+) release, and phosphorylates channels like KCNMA1 and TRPC. It inactivates RhoA, affecting processes like vesicle trafficking and myosin light chain phosphorylation for vasorelaxation. NO-induced PRKG1 activation also alters gene expression, influencing smooth muscle-specific proteins and limiting smooth muscle cell migration. Additionally, it regulates VASP functions in platelets and smooth muscle. PRKG1 Protein, Human (HEK293, His) is the recombinant human-derived PRKG1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PRKG1 Protein, Human (HEK293, His) is 685 a.a., with molecular weight of ~75.0 kDa.

PRKG1, a serine/threonine protein kinase, serves as a key mediator in the nitric oxide (NO)/csignaling pathway. Activation by enables PRKG1 to phosphorylate serines and threonines on various cellular proteins, influencing multiple cellular processes. The protein targets of PRKG1 are diverse, impacting platelet activation and adhesion, smooth muscle contraction, cardiac function, gene expression, and feedback of the NO-signaling pathway. Within the central nervous system, PRKG1 plays roles in axon guidance, hippocampal and cerebellar learning, circadian rhythm, and nociception. Smooth muscle relaxation is achieved through the reduction of intracellular free calcium, desensitization of contractile proteins to calcium, and the modulation of platelet activation. PRKG1 regulates intracellular calcium levels through pathways such as phosphorylation of IRAG1, inhibition of IP3-induced Ca(2+) release, and phosphorylation of KCNMA1 (BKCa) channels. Additionally, PRKG1 influences gene expression in various tissues, impacting smooth muscle-specific contractile proteins and proteins in the NO/csignaling pathway. The activation of PRKG1 by NO signaling also plays a crucial role in inhibiting the Ras homolog gene family member A (RhoA), affecting processes like RHOA translocation, contraction, vesicle trafficking, and myosin light chain phosphorylation, ultimately leading to vasorelaxation. Furthermore, PRKG1 regulates the functions of vasodilator-stimulated phosphoprotein (VASP) in platelets and smooth muscle.

Human

HEK293

C-6*His

Q13976-2 (G2-F686)

5592  [NCBI]

GTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF

Approximately 75.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.