PRKG1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
PRKG1 is a serine/threonine protein kinase that mediates the NO/c signaling pathway and phosphorylates various cellular proteins. It affects platelet activation, smooth muscle contraction, cardiac function, central nervous system processes, etc. PRKG1 Protein, Human (HEK293, His) is the recombinant human-derived PRKG1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PRKG1 is a serine/threonine protein kinase that mediates the NO/c signaling pathway and phosphorylates various cellular proteins. It affects platelet activation, smooth muscle contraction, cardiac function, central nervous system processes, etc. PRKG1 Protein, Human (HEK293, His) is the recombinant human-derived PRKG1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
PRKG1, a serine/threonine protein kinase, serves as a key mediator in the nitric oxide (NO)/csignaling pathway. Activation by enables PRKG1 to phosphorylate serines and threonines on various cellular proteins, influencing multiple cellular processes. The protein targets of PRKG1 are diverse, impacting platelet activation and adhesion, smooth muscle contraction, cardiac function, gene expression, and feedback of the NO-signaling pathway. Within the central nervous system, PRKG1 plays roles in axon guidance, hippocampal and cerebellar learning, circadian rhythm, and nociception. Smooth muscle relaxation is achieved through the reduction of intracellular free calcium, desensitization of contractile proteins to calcium, and the modulation of platelet activation. PRKG1 regulates intracellular calcium levels through pathways such as phosphorylation of IRAG1, inhibition of IP3-induced Ca(2+) release, and phosphorylation of KCNMA1 (BKCa) channels. Additionally, PRKG1 influences gene expression in various tissues, impacting smooth muscle-specific contractile proteins and proteins in the NO/csignaling pathway. The activation of PRKG1 by NO signaling also plays a crucial role in inhibiting the Ras homolog gene family member A (RhoA), affecting processes like RHOA translocation, contraction, vesicle trafficking, and myosin light chain phosphorylation, ultimately leading to vasorelaxation. Furthermore, PRKG1 regulates the functions of vasodilator-stimulated phosphoprotein (VASP) in platelets and smooth muscle.
Verified Bioactivity
The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q13976-2 (G2-F686)
-
Molecular Construction
-
N-term
-
PRKG1 (G2-F686)
Accession # Q13976-2 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
PRKG1; CGKI; Prev. PRKGR1B; Protein Kinase, CGMP-Dependent, Regulatory, Type I, Beta; Prev. PRKG1B; CGMP-Dependent Protein Kinase I; PKG1; CGMP-Dependent Protein Kinase; PKG; CGKI-Alpha; Protein Kinase, CGMP-Dependent, Type I; CGKI-BETA; CGMP-Dependent Pr
-
AA Sequence
GTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
-
Predicted Molecular Mass
78.8 kDa
-
Molecular Weight
Approximately 75 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 6% Sucrose, 4% Mannitol,0.05% Tween 80, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (240 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)