PRLR Protein, Human (Cell-Free, His, Myc)

Prolactin receptor (PRLR) protein, as a receptor for prolactin (PRL), is an important pro-survival factor for sperm. Its key roles include inhibition of sperm capacitation by inhibiting SRC kinase activation while simultaneously stimulating AKT. PRLR Protein, Human (Cell-Free, His, Myc) is the recombinant human-derived PRLR protein, expressed by E. coli Cell-free , with N-10*His, C-Myc labeled tag. The total length of PRLR Protein, Human (Cell-Free, His, Myc) is 598 a.a., with molecular weight of 71.9 kDa.

The Prolactin Receptor (PRLR) protein serves as the receptor for the anterior pituitary hormone prolactin (PRL) and functions as a crucial prosurvival factor for spermatozoa. Its pivotal role involves the inhibition of sperm capacitation through the suppression of SRC kinase activation and the concurrent stimulation of AKT. Notably, both Isoform 4 and Isoform 6 are incapable of transducing prolactin signaling. Upon binding with its hormonal ligand, PRLR undergoes homodimerization, highlighting its activated state. Furthermore, PRLR engages in intricate interactions with SMARCA1, GH1, CSH, NEK3, and VAV2, with the latter two interactions being prolactin-dependent. These collective observations underscore the diverse and finely tuned functions of PRLR, shedding light on its essential role in regulating cellular processes, particularly in the realms of hormonal response and cell survival mechanisms.

Human

E. coli Cell-free

N-10*His;C-Myc

P16471 (Q25-H622)

5618

QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH

71.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.