Promotilin/MLN Protein, Human (HEK293, His)
Promotilin/MLN Protein orchestrates the regulation of interdigestive gastrointestinal motility, inducing rhythmic contractions in the duodenum and colon. As a key player in coordinating gastrointestinal motility, Promotilin/MLN facilitates dynamic movements essential for effective digestive processes. Promotilin/MLN Protein, Human (HEK293, His) is the recombinant human-derived Promotilin/MLN protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Promotilin/MLN Protein orchestrates the regulation of interdigestive gastrointestinal motility, inducing rhythmic contractions in the duodenum and colon. As a key player in coordinating gastrointestinal motility, Promotilin/MLN facilitates dynamic movements essential for effective digestive processes. Promotilin/MLN Protein, Human (HEK293, His) is the recombinant human-derived Promotilin/MLN protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Promotilin/MLN Protein assumes a crucial role in orchestrating the regulation of interdigestive gastrointestinal motility. Its impact is notably indirect, leading to rhythmic contractions of the smooth muscle in both the duodenum and colon. In contributing to the coordination of gastrointestinal motility, Promotilin/MLN emerges as a key player in facilitating the dynamic movements essential for effective digestive processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P12872-1 (F26-K115)
-
Molecular Construction
-
N-term
-
Promotilin (F26-K115)
Accession # P12872-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MLN; Prepromotilin; Motilin; Promotilin
-
AA Sequence
FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
-
Predicted Molecular Mass
11.4 kDa
-
Molecular Weight
Approximately 15-17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
