2. Recombinant Proteins
  3. Others
  4. Promotilin/MLN Protein, Human (HEK293, His)

Promotilin/MLN Protein, Human (HEK293, His)

Cat. No.: HY-P70285
Handling Instructions

Promotilin/MLN Protein orchestrates the regulation of interdigestive gastrointestinal motility, inducing rhythmic contractions in the duodenum and colon. As a key player in coordinating gastrointestinal motility, Promotilin/MLN facilitates dynamic movements essential for effective digestive processes. Promotilin/MLN Protein, Human (HEK293, His) is the recombinant human-derived Promotilin/MLN protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Promotilin/MLN Protein, Human (HEK293, His) is 90 a.a., with molecular weight of 15-17 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Promotilin/MLN Protein orchestrates the regulation of interdigestive gastrointestinal motility, inducing rhythmic contractions in the duodenum and colon. As a key player in coordinating gastrointestinal motility, Promotilin/MLN facilitates dynamic movements essential for effective digestive processes. Promotilin/MLN Protein, Human (HEK293, His) is the recombinant human-derived Promotilin/MLN protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Promotilin/MLN Protein, Human (HEK293, His) is 90 a.a., with molecular weight of 15-17 kDa.
Background

Promotilin/MLN Protein assumes a crucial role in orchestrating the regulation of interdigestive gastrointestinal motility. Its impact is notably indirect, leading to rhythmic contractions of the smooth muscle in both the duodenum and colon. In contributing to the coordination of gastrointestinal motility, Promotilin/MLN emerges as a key player in facilitating the dynamic movements essential for effective digestive processes.
Species

Human
Source

HEK293
Tag

C-6*His
Accession

P12872 (F26-K115)
Gene ID
Molecular Construction
N-term
Promotilin (F26-K115)
Accession # P12872
6*His
C-term
Synonyms
rHuPromotilin/MLN, His ; Promotilin; Motilin-associated peptide; MLN
AA Sequence

FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK

Molecular Weight

15-17 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Promotilin/MLN Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Promotilin/MLN Protein, Human (HEK293, His)
Cat. No.:
HY-P70285
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.