QPCT Protein, Mouse (HEK293, His)

The QPCT protein plays a key role in pyroglutamyl peptide biosynthesis and exhibits substrate preference for N-terminal glutamine residues while showing specificity for residues near the N-terminus. Notably, its catalytic activity is independent of chain length beyond the second residue, emphasizing the importance of QPCT in the precise biosynthesis of pyroglutamyl peptides with diverse N-termini, contributing to various biological background. QPCT Protein, Mouse (HEK293, His) is the recombinant mouse-derived QPCT protein, expressed by HEK293 , with N-His, N-Myc labeled tag. The total length of QPCT Protein, Mouse (HEK293, His) is 327 a.a., with molecular weight of ~41.6 kDa.

The QPCT protein plays a pivotal role in the biosynthesis of pyroglutamyl peptides, exhibiting a preference for substrates with an N-terminal glutaminyl residue while displaying a bias against adjacent acidic and tryptophan residues. Notably, its substrate specificity is more pronounced for the residues proximal to the N-terminal glutaminyl residue, showing a distinctive substrate recognition pattern. Additionally, QPCT demonstrates a lack of significant dependence on chain length beyond the second residue, suggesting that the protein's catalytic activity is less influenced by elongation beyond this point. This selectivity and flexibility in substrate recognition highlight QPCT's significance in the precise biosynthesis of pyroglutamyl peptides, contributing to the diverse array of peptides with pyroglutamylated N-termini in various biological contexts.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

HEK293

N-His;N-Myc

Q9CYK2 (36A-362L)

70536  [NCBI]

AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

Approximately 41.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.