QPCT Protein, Human (sf9, His)

QPCT Protein synthesizes pyroglutamyl peptides, favoring N-terminal glutaminyl residue over adjacent acidic and tryptophan residues. It catalyzes N-terminal pyroglutamate formation, particularly [Glu-3]-amyloid-beta in APP peptides. In lab settings, it aids pyroglutamate formation in truncated amyloid-beta peptides. QPCT Protein may contribute to N-terminal pyroglutamate formation in peptides linked to amyloid-related plaque development. QPCT Protein, Human (sf9, His) is the recombinant human-derived QPCT protein, expressed by Sf9 insect cells , with N-His labeled tag.

QPCT Protein is responsible for the synthesis of pyroglutamyl peptides, displaying a preference against adjacent acidic and tryptophan residues to the N-terminal glutaminyl residue, while showing minimal impact on chain length beyond the second residue. It also catalyzes the formation of N-terminal pyroglutamate. In laboratory settings, it facilitates pyroglutamate formation in truncated forms of APP amyloid-beta peptides, specifically [Glu-3]-amyloid-beta. QPCT Protein might also play a role in the N-terminal pyroglutamate formation of various peptides associated with amyloid-related plaque formation.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

Sf9 insect cells

N-10*His

Q16769-1 (A33-L361)

25797  [NCBI]

Partial

ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

Approximately 39-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCL, 500 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Room temperature in continental US;may vary elsewhere.