Copy Link Print Information

QPCT Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

QPCT Protein synthesizes pyroglutamyl peptides, favoring N-terminal glutaminyl residue over adjacent acidic and tryptophan residues. It catalyzes N-terminal pyroglutamate formation, particularly [Glu-3]-amyloid-beta in APP peptides. In lab settings, it aids pyroglutamate formation in truncated amyloid-beta peptides. QPCT Protein may contribute to N-terminal pyroglutamate formation in peptides linked to amyloid-related plaque development. QPCT Protein, Human (sf9, His) is the recombinant human-derived QPCT protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Experimental Validation Results for QPCT Protein, Human (sf9, His)
  • QPCT Protein, Human (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

QPCT Protein synthesizes pyroglutamyl peptides, favoring N-terminal glutaminyl residue over adjacent acidic and tryptophan residues. It catalyzes N-terminal pyroglutamate formation, particularly [Glu-3]-amyloid-beta in APP peptides. In lab settings, it aids pyroglutamate formation in truncated amyloid-beta peptides. QPCT Protein may contribute to N-terminal pyroglutamate formation in peptides linked to amyloid-related plaque development. QPCT Protein, Human (sf9, His) is the recombinant human-derived QPCT protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

QPCT Protein is responsible for the synthesis of pyroglutamyl peptides, displaying a preference against adjacent acidic and tryptophan residues to the N-terminal glutaminyl residue, while showing minimal impact on chain length beyond the second residue. It also catalyzes the formation of N-terminal pyroglutamate. In laboratory settings, it facilitates pyroglutamate formation in truncated forms of APP amyloid-beta peptides, specifically [Glu-3]-amyloid-beta. QPCT Protein might also play a role in the N-terminal pyroglutamate formation of various peptides associated with amyloid-related plaque formation.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-10*His
  • Accession

    Q16769-1 (A33-L361)

  • Gene ID
    25797  [NCBI]
  • Molecular Construction
    • N-term
    • 10*His
    • QPCT (A33-L361)
      Accession # Q16769-1
    • C-term
  • Protein Length

    Full Length of Glutaminyl-peptide cyclotransferase Chain

  • Synonyms

    QPCT; GCT; Glutaminyl-Peptide Cyclotransferase; Glutamyl Cyclase; Glutaminyl Cyclase; SQC; QC; EC; Glutaminyl-TRNA Cyclotransferase

  • AA Sequence

    ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

  • Predicted Molecular Mass

    38.9 kDa

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCL, 500 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • QPCT Protein, Human (sf9, His) Product Image
    1/16
  • Experimental Validation Results for QPCT Protein, Human (sf9, His)
  • QPCT Protein, Human (sf9, His) Product Image