1. Recombinant Proteins
  2. Others
  3. R-spondin 3 Protein, Human (125aa, HEK293, His)

R-spondin 3 Protein, Human (125aa, HEK293, His)

Cat. No.: HY-P700262
COA Handling Instructions

RSPO3 is a potent activator of the canonical Wnt pathway and can bind to LGR4-6 receptors to initiate a complex with phosphorylated LRP6 and Frizzled receptors. This interaction activates the canonical Wnt pathway and upregulates target genes. R-spondin 3 Protein, Human (125aa, HEK293, His) is the recombinant human-derived R-spondin 3 protein, expressed by HEK293 , with C-His labeled tag. The total length of R-spondin 3 Protein, Human (125aa, HEK293, His) is 125 a.a., with molecular weight of 16 & (20-24) kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $60 In-stock
10 μg $103 In-stock
50 μg $290 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RSPO3 is a potent activator of the canonical Wnt pathway and can bind to LGR4-6 receptors to initiate a complex with phosphorylated LRP6 and Frizzled receptors. This interaction activates the canonical Wnt pathway and upregulates target genes. R-spondin 3 Protein, Human (125aa, HEK293, His) is the recombinant human-derived R-spondin 3 protein, expressed by HEK293 , with C-His labeled tag. The total length of R-spondin 3 Protein, Human (125aa, HEK293, His) is 125 a.a., with molecular weight of 16 & (20-24) kDa, respectively.

Background

R-Spondin 3 (RSPO3) serves as a potent activator of the canonical Wnt signaling pathway, acting as a ligand for LGR4-6 receptors and playing a pivotal role in angiogenesis regulation. Upon binding to LGR4-6 (LGR4, LGR5, or LGR6), the resulting complex associates with phosphorylated LRP6 and frizzled receptors, activated by extracellular Wnt receptors. This interaction triggers the canonical Wnt signaling pathway, leading to an upregulation of target gene expression. RSPO3 also acts as a multifaceted regulator by inhibiting ZNRF3, a crucial component of the Wnt signaling pathway, and serving as a ligand for frizzled FZD8 and LRP6. It may additionally exert negative regulation on the TGF-beta pathway. In the context of angiogenesis, RSPO3 emerges as a key player, controlling vascular stability and pruning by activating the non-canonical Wnt signaling pathway in endothelial cells. Remarkably, RSPO3 exhibits the capability to amplify the Wnt signaling pathway independently of LGR4-6 receptors, possibly through direct antagonistic interactions with RNF43 and ZNRF3. Interactions with the extracellular domain of FZD8 and LRP6, along with binding to WNT1 and LGR4, LGR5, and LGR6, underscore the intricate regulatory mechanisms orchestrated by RSPO3 in Wnt signaling modulation.

Biological Activity

Measured by the ability to enhance BMP-2 induced alkaline phosphatase activity in MC3T3-E1 cells. The ED50 for this effect is 1.787 μg/mL .

Species

Human

Source

HEK293

Tag

C-His

Accession

Q9BXY4-1 (Q22-V146)

Gene ID
Molecular Construction
N-term
R-spondin 3 (Q22-V146)
Accession # Q9BXY4-1
His
C-term
Synonyms
R-spondin-3; RSPO3; Protein with TSP type-1 repeat; PWTSR; THSD2; CRISTIN1
AA Sequence

QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIV

Molecular Weight

16 & (20-24) kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

R-spondin 3 Protein, Human (125aa, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
R-spondin 3 Protein, Human (125aa, HEK293, His)
Cat. No.:
HY-P700262
Quantity:
MCE Japan Authorized Agent: