RBP7 Protein, Human (His)

RBP7 protein, a member of the CRBP family, is involved in the stability and metabolism of vitamin A. It binds to all-trans-retinol but with lower affinity compared to other CRBPs. RBP7 protein is expressed in fat, spleen, and other tissues, indicating possible tissue-specific functions. RBP7 Protein, Human (His) is the recombinant human-derived RBP7 protein, expressed by E. coli , with N-6*His labeled tag. The total length of RBP7 Protein, Human (His) is 133 a.a., with molecular weight of ~16 kDa.

The RBP7 protein, belonging to the cellular retinol-binding protein (CRBP) family, plays a crucial role in the stability and metabolism of vitamin A. It exhibits a binding affinity for all-trans-retinol and shares structural similarities with other CRBPs, although its binding affinity for retinol is comparatively lower. Besides its general functions, this protein shows biased expression in fat (RPKM 138.2), spleen (RPKM 25.4), and seven other tissues, suggesting potential tissue-specific roles.

Data is not available.

Human

E. coli

N-6*His

NP_443192.1 (P2-A134)

116362  [NCBI]

PADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

Approximately 16 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.