REG-1 beta/REG1B Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

REG1B Protein potentially inhibits spontaneous calcium carbonate precipitation and may be associated with neuronal sprouting in the brain. It also contributes to the regeneration of brain and pancreas tissues. REG-1 beta/REG1B Protein, Human (HEK293, His) is the recombinant human-derived REG-1 beta/REG1B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

REG1B Protein potentially inhibits spontaneous calcium carbonate precipitation and may be associated with neuronal sprouting in the brain. It also contributes to the regeneration of brain and pancreas tissues. REG-1 beta/REG1B Protein, Human (HEK293, His) is the recombinant human-derived REG-1 beta/REG1B protein, expressed by HEK293 , with C-His labeled tag.

Background

REG1B protein potentially acts as an inhibitor of spontaneous calcium carbonate precipitation and may be linked to processes such as neuronal sprouting in the brain, as well as participating in the regeneration of brain and pancreas tissues.

Verified Bioactivity

Measured in a cell proliferation assay using RT4‑D6P2T rat schwannoma cells. The ED50 for this effect is 0.657 μg/mL, corresponding to a specific activity is 1.522×10^3 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • REG1B (Q23-N166)
      Accession # P48304
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    REG1B; Secretory Pancreatic Stone Protein 2; Regenerating Family Member 1 Beta; Regenerating Protein I Beta; PSPS2; Pancreatic Stone Protein 2; REGL; Lithostathine-1-Beta; Regenerating Islet-Derived 1 Beta (Pancreatic Stone Protein, Pancreatic Thread Prot

  • AA Sequence

    QESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

  • Molecular Weight

    Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00