REG-1 beta/REG1B Protein, Human (HEK293, His)

REG1B Protein potentially inhibits spontaneous calcium carbonate precipitation and may be associated with neuronal sprouting in the brain. It also contributes to the regeneration of brain and pancreas tissues. REG-1 beta/REG1B Protein, Human (HEK293, His) is the recombinant human-derived REG-1 beta/REG1B protein, expressed by HEK293 , with C-His labeled tag. The total length of REG-1 beta/REG1B Protein, Human (HEK293, His) is 144 a.a., with molecular weight of ~19-20 kDa.

REG1B protein potentially acts as an inhibitor of spontaneous calcium carbonate precipitation and may be linked to processes such as neuronal sprouting in the brain, as well as participating in the regeneration of brain and pancreas tissues.

Measured in a cell proliferation assay using RT4‑D6P2T rat schwannoma cells. The ED₅₀ for this effect is 0.657 μg/mL, corresponding to a specific activity is 1.522×10^3 units/mg.

Human

HEK293

C-His

P48304 (Q23-N166)

5968  [NCBI]

QESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN

Approximately 19-20 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.