REG-1 beta/REG1B Protein, Human (HEK293, His)
Based on 1 Customer Validation
REG1B Protein potentially inhibits spontaneous calcium carbonate precipitation and may be associated with neuronal sprouting in the brain. It also contributes to the regeneration of brain and pancreas tissues. REG-1 beta/REG1B Protein, Human (HEK293, His) is the recombinant human-derived REG-1 beta/REG1B protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
REG1B Protein potentially inhibits spontaneous calcium carbonate precipitation and may be associated with neuronal sprouting in the brain. It also contributes to the regeneration of brain and pancreas tissues. REG-1 beta/REG1B Protein, Human (HEK293, His) is the recombinant human-derived REG-1 beta/REG1B protein, expressed by HEK293 , with C-His labeled tag.
Background
REG1B protein potentially acts as an inhibitor of spontaneous calcium carbonate precipitation and may be linked to processes such as neuronal sprouting in the brain, as well as participating in the regeneration of brain and pancreas tissues.
Verified Bioactivity
Measured in a cell proliferation assay using RT4‑D6P2T rat schwannoma cells. The ED50 for this effect is 0.657 μg/mL, corresponding to a specific activity is 1.522×10^3 units/mg.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P48304 (Q23-N166)
-
Molecular Construction
-
N-term
-
REG1B (Q23-N166)
Accession # P48304 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
REG1B; Secretory Pancreatic Stone Protein 2; Regenerating Family Member 1 Beta; Regenerating Protein I Beta; PSPS2; Pancreatic Stone Protein 2; REGL; Lithostathine-1-Beta; Regenerating Islet-Derived 1 Beta (Pancreatic Stone Protein, Pancreatic Thread Prot
-
AA Sequence
QESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN
-
Molecular Weight
Approximately 19-21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
