REG-4 Protein, Human (HEK293, His)
Based on 1 Customer Validation
REG-4 is a calcium-independent lectin with mannose-binding specificity that retains carbohydrate recognition activity even in acidic environments. Its ability to act independently of calcium indicates its potent and versatile lectin activity. REG-4 Protein, Human (HEK293, His) is the recombinant human-derived REG-4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
REG-4 is a calcium-independent lectin with mannose-binding specificity that retains carbohydrate recognition activity even in acidic environments. Its ability to act independently of calcium indicates its potent and versatile lectin activity. REG-4 Protein, Human (HEK293, His) is the recombinant human-derived REG-4 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
REG-4, a calcium-independent lectin, exhibits a specific affinity for mannose and retains its carbohydrate recognition activity even in acidic environments. This suggests a robust and adaptable molecular structure that may function effectively under varying physiological conditions. REG-4 is implicated in inflammatory and metaplastic responses within the gastrointestinal epithelium, indicating its potential role in the regulation of cellular processes associated with inflammation and tissue transformation. The mannose-binding specificity of REG-4 suggests its involvement in recognizing and interacting with glycoproteins or other molecules displaying mannose residues, possibly contributing to immune responses or cell signaling in the gastrointestinal context.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9BYZ8-1 (D23-P158)
-
Molecular Construction
-
N-term
-
REG-4 (D23-P158)
Accession # Q9BYZ8-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
REG4; Regenerating Islet-Derived Protein IV; Regenerating Family Member 4; Regenerating Islet-Derived Protein 4; RELP; Regenerating Gene Type IV; GISP; REG-Like Protein; Gastrointestinal Secretory Protein; Reg IV; REG-IV; REG-4; Regenerating Islet-Derived
-
AA Sequence
DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
-
Predicted Molecular Mass
19.2 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM HIS-HCl, 5% Sucrose, 5% mannitol, 0.05% Tween 80, pH 6.0.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
