REG-4 Protein, Human (HEK293, His)

REG-4 is a calcium-independent lectin with mannose-binding specificity that retains carbohydrate recognition activity even in acidic environments. Its ability to act independently of calcium indicates its potent and versatile lectin activity. REG-4 Protein, Human (HEK293, His) is the recombinant human-derived REG-4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of REG-4 Protein, Human (HEK293, His) is 136 a.a., with molecular weight of ~16.0 kDa.

REG-4, a calcium-independent lectin, exhibits a specific affinity for mannose and retains its carbohydrate recognition activity even in acidic environments. This suggests a robust and adaptable molecular structure that may function effectively under varying physiological conditions. REG-4 is implicated in inflammatory and metaplastic responses within the gastrointestinal epithelium, indicating its potential role in the regulation of cellular processes associated with inflammation and tissue transformation. The mannose-binding specificity of REG-4 suggests its involvement in recognizing and interacting with glycoproteins or other molecules displaying mannose residues, possibly contributing to immune responses or cell signaling in the gastrointestinal context.

Human

HEK293

C-6*His

Q9BYZ8 (D23-P158)

83998  [NCBI]

DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP

Approximately 16.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.