RGMA Protein, Human (His)

Repulsive guidance molecule A (RGMA) is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. RGMA regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formation of mature synapses. RGMA also functions as a bone morphogenetic protein (BMP) coreceptor and may act as a tumor suppressor in some cancers. RGMA Protein, Human (His) is the recombinant human-derived RGMA protein, expressed by E. coli , with N-6*His labeled tag. The total length of RGMA Protein, Human (His) is 254 a.a., with molecular weight of ~30.0 kDa.

Repulsive guidance molecule A (RGMA) is a member of the repulsive guidance molecule family. RGMA is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. RGMA regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formation of mature synapses. RGMA induces activation of RHOA-ROCK1/Rho-kinase signaling pathway through UNC5B-ARHGEF12/LARG-PTK2/FAK1 cascade by Binding to receptor NEO1/neogenin, leading to collapse of the neuronal growth cone and neurite outgrowth inhibition. NEO1/neogenin binding of RGMA leads to HRAS inactivation by influencing HRAS-PTK2/FAK1-AKT1 pathway as well. RGMA also functions as a bone morphogenetic protein (BMP) coreceptor that may signal through SMAD1, SMAD5, and SMAD8. RGMA may also function as a tumor suppressor in some cancers^[1][2][3].

Human

E. coli

N-6*His

AAI51133.1 (P169-G422)

56963  [NCBI]

PHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPG

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.