S100B Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
S100B protein is encoded by the S100B gene and is a member of the S100 family. It regulates cellular processes such as cell cycle progression and differentiation. S100B Protein, Human (HEK293, Fc) is the recombinant human-derived S100B protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
S100B protein is encoded by the S100B gene and is a member of the S100 family. It regulates cellular processes such as cell cycle progression and differentiation. S100B Protein, Human (HEK293, Fc) is the recombinant human-derived S100B protein, expressed by HEK293 , with N-hFc labeled tag.
Background
The S100B gene encodes a protein belonging to the S100 family, characterized by 2 EF-hand calcium-binding motifs. S100 proteins are found in the cytoplasm and/or nucleus of various cells, playing crucial roles in regulating cellular processes such as cell cycle progression and differentiation. While most S100 genes are clustered on chromosome 1q21, S100B is uniquely located at 21q22.3. This protein is implicated in neurite extension, melanoma cell proliferation, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, as well as inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of S100B are associated with various diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. Notably, its expression is biased, with significant levels observed in the brain, fat, and select other tissues.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized recombinant human S100B at 10 μg/mL (100 μl/well) can bind biotinylated human S100A1 (HY-P74589). The ED50 for this effect is 150-250 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
NP_006263.1 (S2-E92)
-
Molecular Construction
-
N-term
-
hFc
-
S100B (S2-E92)
Accession # NP_006263.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100B; S100 Calcium-Binding Protein B; S100 Calcium Binding Protein B; S100 Calcium-Binding Protein; S100beta; S-100 Protein Beta Chain; S-100 Protein Subunit Beta; Protein S100; Protein S100-B; S100-B; S100 Calcium Binding Protein, Beta (Neural); S100; S
-
AA Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
