S100B Protein, Human (HEK293, Fc)

S100B protein is encoded by the S100B gene and is a member of the S100 family. It regulates cellular processes such as cell cycle progression and differentiation. S100B Protein, Human (HEK293, Fc) is the recombinant human-derived S100B protein, expressed by HEK293 , with N-hFc labeled tag. The total length of S100B Protein, Human (HEK293, Fc) is 91 a.a., with molecular weight of ~40 kDa.

The S100B gene encodes a protein belonging to the S100 family, characterized by 2 EF-hand calcium-binding motifs. S100 proteins are found in the cytoplasm and/or nucleus of various cells, playing crucial roles in regulating cellular processes such as cell cycle progression and differentiation. While most S100 genes are clustered on chromosome 1q21, S100B is uniquely located at 21q22.3. This protein is implicated in neurite extension, melanoma cell proliferation, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, as well as inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of S100B are associated with various diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. Notably, its expression is biased, with significant levels observed in the brain, fat, and select other tissues.

Measured by its binding ability in a functional ELISA. Immobilized recombinant human S100B at 10 μg/mL (100 μl/well) can bind biotinylated human S100A1. The ED₅₀ for this effect is 153.8 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized recombinant human S100B at 10 μg/mL (100 μl/well) can bind biotinylated human S100A1. The ED₅₀ for this effect is 153.8 ng/mL.

Human

HEK293

N-hFc

NP_006263.1 (S2-E92)

6285  [NCBI]

SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Approximately 40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.