SCGB1A1 Protein, Rat (His)
Based on 1 Customer Validation
SCGB1A1 Protein demonstrates diverse binding abilities, interacting with phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB), and, to a lesser extent, progesterone.It acts as a robust phospholipase A2 inhibitor, forming an antiparallel homodimer linked by disulfide bonds.Although there is controversy regarding its interaction with LMBR1L, additional research is necessary for clarification.SCGB1A1 Protein, Rat (His) is the recombinant rat-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SCGB1A1 Protein demonstrates diverse binding abilities, interacting with phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB), and, to a lesser extent, progesterone.It acts as a robust phospholipase A2 inhibitor, forming an antiparallel homodimer linked by disulfide bonds.Although there is controversy regarding its interaction with LMBR1L, additional research is necessary for clarification.SCGB1A1 Protein, Rat (His) is the recombinant rat-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.
Background
SCGB1A1 protein exhibits versatile binding capabilities, including phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB), and progesterone to a lesser extent. It serves as a potent inhibitor of phospholipase A2. Structurally, it forms an antiparallel homodimer that is disulfide-linked. While there is some controversy surrounding its interaction with LMBR1L, further investigation is required to clarify this aspect.
Verified Bioactivity
Measured by the ability of the immobilized protein to affect the adhesion of the A549 human lung carcinoma cells in the presence of Fibronectin. The ED50 for this effect is 3.142 μg/mL, corresponding to a specific activity is 318.27 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-6*His
-
Accession
P17559 (S20-V96)
-
Molecular Construction
-
N-term
-
6*His
-
SCGB1A1 (S20-V96)
Accession # P17559 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SCGB1A1; Urinary Protein 1; Prev. UGB; CCPBP; Uteroglobin; UP-1; CC10; UP1; CCSP; Secretoglobin, Family 1A, Member 1 (Uteroglobin); CC16; Uteroglobin (Clara Cell Specific 10-KD Protein); Club Cell Phospholipid-Binding Protein; Uteroglobin (Club-Cell Speci
-
AA Sequence
SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV
-
Predicted Molecular Mass
8.5 kDa
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
