SCGB3A2 Protein, Mouse (His, GST)

Customer Review

Based on 1 Customer Validation

SCGB3A2 is a secreted cytokine-like protein that interacts with pathogens (Listeria monocytogenes, Pseudomonas aeruginosa, yeast) and binds to the scavenger receptor MARCO. It strongly inhibits PLA2G1B activity and regulates lipid metabolism. SCGB3A2 Protein, Mouse (His, GST) is the recombinant mouse-derived SCGB3A2 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SCGB3A2 is a secreted cytokine-like protein that interacts with pathogens (Listeria monocytogenes, Pseudomonas aeruginosa, yeast) and binds to the scavenger receptor MARCO. It strongly inhibits PLA2G1B activity and regulates lipid metabolism. SCGB3A2 Protein, Mouse (His, GST) is the recombinant mouse-derived SCGB3A2 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Background

SCGB3A2 is a secreted cytokine-like protein that exhibits diverse functions, including binding to the scavenger receptor MARCO and interacting with various pathogens such as the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Notably, it strongly inhibits phospholipase A2 (PLA2G1B) activity, showcasing its regulatory role in lipid metabolism. SCGB3A2 demonstrates anti-inflammatory effects in respiratory epithelium and exerts anti-fibrotic activity in the lung. It may contribute to fetal lung development and maturation, promoting branching morphogenesis during early stages of lung development. Additionally, in the pituitary, SCGB3A2 is implicated in inhibiting the production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH). The protein exists as a homodimer, linked by disulfide bonds, and can also function as a monomer. Furthermore, SCGB3A2 interacts with APOA1, emphasizing its involvement in diverse physiological processes.

Verified Bioactivity

Measured in a cytotoxicity assay using A549 cells in the presence of 0.5 μg/mL LPS (HY-D1056). The ED50 of this effect is <1 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-GST;N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    SCGB3A2; Pneumo Secretory Protein 1; Secretoglobin Family 3A Member 2; LU103; UGRP1; Uteroglobin Related Protein 1; PNSP1; PnSP-1; Uteroglobin-Related Protein 1; Secretoglobin, Family 3A, Member 2

  • AA Sequence

    LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

  • Molecular Weight

    Approximately 43 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, pH 7.4, 6% or 8% Trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00