SCGB3A2 Protein, Mouse (His, GST)
Based on 1 Customer Validation
SCGB3A2 is a secreted cytokine-like protein that interacts with pathogens (Listeria monocytogenes, Pseudomonas aeruginosa, yeast) and binds to the scavenger receptor MARCO. It strongly inhibits PLA2G1B activity and regulates lipid metabolism. SCGB3A2 Protein, Mouse (His, GST) is the recombinant mouse-derived SCGB3A2 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SCGB3A2 is a secreted cytokine-like protein that interacts with pathogens (Listeria monocytogenes, Pseudomonas aeruginosa, yeast) and binds to the scavenger receptor MARCO. It strongly inhibits PLA2G1B activity and regulates lipid metabolism. SCGB3A2 Protein, Mouse (His, GST) is the recombinant mouse-derived SCGB3A2 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.
Background
SCGB3A2 is a secreted cytokine-like protein that exhibits diverse functions, including binding to the scavenger receptor MARCO and interacting with various pathogens such as the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Notably, it strongly inhibits phospholipase A2 (PLA2G1B) activity, showcasing its regulatory role in lipid metabolism. SCGB3A2 demonstrates anti-inflammatory effects in respiratory epithelium and exerts anti-fibrotic activity in the lung. It may contribute to fetal lung development and maturation, promoting branching morphogenesis during early stages of lung development. Additionally, in the pituitary, SCGB3A2 is implicated in inhibiting the production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH). The protein exists as a homodimer, linked by disulfide bonds, and can also function as a monomer. Furthermore, SCGB3A2 interacts with APOA1, emphasizing its involvement in diverse physiological processes.
Verified Bioactivity
Measured in a cytotoxicity assay using A549 cells in the presence of 0.5 μg/mL LPS (HY-D1056). The ED50 of this effect is <1 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-GST;N-6*His
-
Accession
Q920H1-1 (L22-L139)
-
Protein Length
Partial
-
Synonyms
SCGB3A2; Pneumo Secretory Protein 1; Secretoglobin Family 3A Member 2; LU103; UGRP1; Uteroglobin Related Protein 1; PNSP1; PnSP-1; Uteroglobin-Related Protein 1; Secretoglobin, Family 3A, Member 2
-
AA Sequence
LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL
-
Molecular Weight
Approximately 43 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm sterile filtered PBS, pH 7.4, 6% or 8% Trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)