SCGB3A2 Protein, Mouse (His, GST)

SCGB3A2 is a secreted cytokine-like protein that interacts with pathogens (Listeria monocytogenes, Pseudomonas aeruginosa, yeast) and binds to the scavenger receptor MARCO. It strongly inhibits PLA2G1B activity and regulates lipid metabolism. SCGB3A2 Protein, Mouse (His, GST) is the recombinant mouse-derived SCGB3A2 protein, expressed by E. coli , with N-GST, N-6*His labeled tag. The total length of SCGB3A2 Protein, Mouse (His, GST) is 118 a.a., with molecular weight of ~43.2 kDa.

SCGB3A2 is a secreted cytokine-like protein that exhibits diverse functions, including binding to the scavenger receptor MARCO and interacting with various pathogens such as the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Notably, it strongly inhibits phospholipase A2 (PLA2G1B) activity, showcasing its regulatory role in lipid metabolism. SCGB3A2 demonstrates anti-inflammatory effects in respiratory epithelium and exerts anti-fibrotic activity in the lung. It may contribute to fetal lung development and maturation, promoting branching morphogenesis during early stages of lung development. Additionally, in the pituitary, SCGB3A2 is implicated in inhibiting the production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH). The protein exists as a homodimer, linked by disulfide bonds, and can also function as a monomer. Furthermore, SCGB3A2 interacts with APOA1, emphasizing its involvement in diverse physiological processes.

Mouse

E. coli

N-GST;N-6*His

Q920H1 (L22-L139)

117158  [NCBI]

LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Approximately 43.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.