SIRP gamma Protein, Cynomolgus (HEK293, His)

SIRP gamma Protein, a member of signal-regulatory protein (SIRP) family, is the only SIRP detected on T cells and activated NK cells. SIRP gamma can bind CD47, providing T cells and NK cells with a cell surface molecule capable of interacting with CD47. SIRP gamma-CD47 interaction mediates strong cell-cell adhesion and supports T cell-APC contact, enhancing antigen presentation and consequent T-cell proliferation and cytokine secretion. SIRP gamma Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived SIRP gamma protein, expressed by HEK293 , with C-His labeled tag.

SIRP gamma (SIRPG), a member of signal-regulatory protein (SIRP) family, is the only SIRP detected on T cells and activated NK cells. It emerges as a immunoglobulin-like cell surface receptor, demonstrating its role in mediating cell-cell adhesion upon binding with CD47. This interaction is pivotal in enhancing antigen-specific T-cell proliferation and providing costimulatory signals for T-cell activation. As a result, SIRP gamma engages with CD47 on antigen-presenting cells, highlighting its involvement in modulating immune responses. SIRP gamma-CD47 interaction mediates strong cell-cell adhesion and supports T cell-APC contact, enhancing antigen presentation and consequent T-cell proliferation and cytokine secretion^[1].

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells. The ED₅₀ for this effect is 0.752 μg/mL in the presence of 5 μg/mL anti-CD3. Corresponding to a specific activity is 1.330×10³ Unit/mg.

Cynomolgus

HEK293

C-His

XP_028684116 (E29-H360)

716034  [NCBI]

Partial

EEELQMIQPEKLLLVAVGESATLNCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADAGTYYCVKFRKGSPENVEFKSGPGTEMALRAKPSAPVVSGPAARATPEHTVSFTCKSHGFSPRDITLKWFKNGNELSDFQTNVDPAGQSVSYSIRSTARVVLAPWDVRSQVTCEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPIRAGNQVNITYQVRNFYPQNLQLTWLENGNVCRTETASTLTENKDGTYNWTSWLLVNTSDQRDDVVLTCQVKHDGQLAVNKSLVLEVSAHQKDQSSDATH

Approximately 45 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Piccio L, et al. Adhesion of human T cells to antigen-presenting cells through SIRPbeta2-CD47 interaction costimulates T-cell proliferation. Blood. 2005 Mar 15;105(6):2421-7.  [Content Brief]