SMUG1 Protein, Human (His-SUMO)
SMUG1 protein is a single-function DNA glycosylase that plays a crucial role in base excision DNA repair, especially the recognition and repair of uracil (U) residues, preferentially recognizing mismatches (U/G) rather than matching (U/A).Its activity extends to the excision of 5-formyluracil (fU), 5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU) in single-stranded (ssDNA) and double-stranded DNA (dsDNA).SMUG1 Protein, Human (His-SUMO) is the recombinant human-derived SMUG1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SMUG1 protein is a single-function DNA glycosylase that plays a crucial role in base excision DNA repair, especially the recognition and repair of uracil (U) residues, preferentially recognizing mismatches (U/G) rather than matching (U/A).Its activity extends to the excision of 5-formyluracil (fU), 5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU) in single-stranded (ssDNA) and double-stranded DNA (dsDNA).SMUG1 Protein, Human (His-SUMO) is the recombinant human-derived SMUG1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
Background
The SMUG1 protein serves as a pivotal factor in base excision DNA repair, specifically recognizing and initiating repair processes for base lesions in the genome. Functioning as a monofunctional DNA glycosylase, SMUG1 displays specificity for uracil (U) residues in DNA, with a notable preference for single-stranded DNA substrates. Its enzymatic activity is more pronounced toward mismatches (U/G) compared to matches (U/A). SMUG1 exhibits the capability to excise not only uracil (U) but also 5-formyluracil (fU), and uracil derivatives with oxidized groups at C5, such as 5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU), in both single-stranded (ssDNA) and double-stranded DNA (dsDNA). Importantly, this DNA glycosylase does not act on analogous cytosine derivatives (5-hydroxycytosine and 5-formylcytosine), nor other oxidized bases. SMUG1's activity is damage-specific and exhibits dependence on salt concentration, with a substrate preference hierarchy of ssDNA > dsDNA (G pair) = dsDNA (A pair) under low salt conditions, and dsDNA (G pair) > dsDNA (A pair) > ssDNA under high salt concentrations.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q53HV7-2 (M1-L177)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
SMUG1 (M1-L177)
Accession # Q53HV7-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
SMUG1; FDG; Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1; Single-Strand Selective Monofunctional Uracil DNA Glycosylase; HMUDG; Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 Isoform 1; UNG3; Single-Strand-Selective Mon
-
AA Sequence
MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL
-
Predicted Molecular Mass
35.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)