SMUG1 Protein, Human (His-SUMO)

SMUG1 protein is a single-function DNA glycosylase that plays a crucial role in base excision DNA repair, especially the recognition and repair of uracil (U) residues, preferentially recognizing mismatches (U/G) rather than matching (U/A).Its activity extends to the excision of 5-formyluracil (fU), 5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU) in single-stranded (ssDNA) and double-stranded DNA (dsDNA).SMUG1 Protein, Human (His-SUMO) is the recombinant human-derived SMUG1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SMUG1 protein is a single-function DNA glycosylase that plays a crucial role in base excision DNA repair, especially the recognition and repair of uracil (U) residues, preferentially recognizing mismatches (U/G) rather than matching (U/A).Its activity extends to the excision of 5-formyluracil (fU), 5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU) in single-stranded (ssDNA) and double-stranded DNA (dsDNA).SMUG1 Protein, Human (His-SUMO) is the recombinant human-derived SMUG1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Background

The SMUG1 protein serves as a pivotal factor in base excision DNA repair, specifically recognizing and initiating repair processes for base lesions in the genome. Functioning as a monofunctional DNA glycosylase, SMUG1 displays specificity for uracil (U) residues in DNA, with a notable preference for single-stranded DNA substrates. Its enzymatic activity is more pronounced toward mismatches (U/G) compared to matches (U/A). SMUG1 exhibits the capability to excise not only uracil (U) but also 5-formyluracil (fU), and uracil derivatives with oxidized groups at C5, such as 5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU), in both single-stranded (ssDNA) and double-stranded DNA (dsDNA). Importantly, this DNA glycosylase does not act on analogous cytosine derivatives (5-hydroxycytosine and 5-formylcytosine), nor other oxidized bases. SMUG1's activity is damage-specific and exhibits dependence on salt concentration, with a substrate preference hierarchy of ssDNA > dsDNA (G pair) = dsDNA (A pair) under low salt conditions, and dsDNA (G pair) > dsDNA (A pair) > ssDNA under high salt concentrations.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • SMUG1 (M1-L177)
      Accession # Q53HV7-2
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    SMUG1; FDG; Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1; Single-Strand Selective Monofunctional Uracil DNA Glycosylase; HMUDG; Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 Isoform 1; UNG3; Single-Strand-Selective Mon

  • AA Sequence

    MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL

  • Predicted Molecular Mass

    35.6 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00