SP-10/ACRV1 Protein, Human (HEK293, C-His)
Based on 1 Customer Validation
SP-10/ACRV1 Protein is a testis-specific acrosomal matrix protein, which is evolutionarily conserved among mammals. The gene coding for the SP-10 protein, Acrv1, served as an outstanding model to understand the regulation of male germ-cell-specific gene transcription. The human and mouse SP-10 proteins share homology in the carboxyl terminal region, but contain distinct amino termini. SP-10 probably has an important role in human sperm function, is a promising contraceptive vaccine immunogen for humans, and can serve as a marker protein. SP-10/ACRV1 Protein, Human (HEK293, C-His) is the recombinant human-derived SP-10/ACRV1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SP-10/ACRV1 Protein is a testis-specific acrosomal matrix protein, which is evolutionarily conserved among mammals. The gene coding for the SP-10 protein, Acrv1, served as an outstanding model to understand the regulation of male germ-cell-specific gene transcription. The human and mouse SP-10 proteins share homology in the carboxyl terminal region, but contain distinct amino termini. SP-10 probably has an important role in human sperm function, is a promising contraceptive vaccine immunogen for humans, and can serve as a marker protein[1][2]. SP-10/ACRV1 Protein, Human (HEK293, C-His) is the recombinant human-derived SP-10/ACRV1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
SP-10 is an abundant protein present in both the acrosomal matrix as well as in the inner acrosomal membrane. The SP-10 antibody has been shown to be useful for staging the seminiferous cycle in the mouse and human[1].
A full-length 45-kDa SP-10 precursor protein is present in the testis and that SP-10 peptides of 32, 30, 28, and 26 kDa result from proteolytic processing of the SP-10 precursor protein in the testis and/or alternative splicing[2].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P26436-1 (Q22-I265)
-
Molecular Construction
-
N-term
-
ACRV1 (Q22-I265)
Accession # P26436 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ACRV1; SP-10; Acrosomal Vesicle Protein 1; Acrosomal Protein SP-10; D11S4365; Sperm Protein 10; SPACA2; Acrosomal Vesicle Protein 1 Isoform B
-
AA Sequence
QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
-
Molecular Weight
Approximately 35-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
