SP-10/ACRV1 Protein, Human (HEK293, C-His)

SP-10/ACRV1 Protein is a testis-specific acrosomal matrix protein, which is evolutionarily conserved among mammals. The gene coding for the SP-10 protein, Acrv1, served as an outstanding model to understand the regulation of male germ-cell-specific gene transcription. The human and mouse SP-10 proteins share homology in the carboxyl terminal region, but contain distinct amino termini. SP-10 probably has an important role in human sperm function, is a promising contraceptive vaccine immunogen for humans, and can serve as a marker protein^[1][2]. SP-10/ACRV1 Protein, Human (HEK293, C-His) is the recombinant human-derived SP-10/ACRV1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SP-10/ACRV1 Protein, Human (HEK293, C-His) is 244 a.a., with molecular weight of ~35.0 kDa.

SP-10 is an abundant protein present in both the acrosomal matrix as well as in the inner acrosomal membrane. The SP-10 antibody has been shown to be useful for staging the seminiferous cycle in the mouse and human^[1].
A full-length 45-kDa SP-10 precursor protein is present in the testis and that SP-10 peptides of 32, 30, 28, and 26 kDa result from proteolytic processing of the SP-10 precursor protein in the testis and/or alternative splicing^[2].

Human

HEK293

C-6*His

P26436 (Q22-I265)

56  [NCBI]

QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI

Approximately 35.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.