SPARC Protein, Human
Based on 1 Customer Validation
SPARC Protein, Human is a Ca2+-binding glycoprotein that is differentially associated with morphogenesis, remodeling, cellular migration, and proliferation.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
SPARC Protein, Human is a Ca2+-binding glycoprotein that is differentially associated with morphogenesis, remodeling, cellular migration, and proliferation.
SPARC (secreted protein, acidic and rich in cysteine) is the founding member of a family of secreted matricellular proteins with similar domain structure. SPARC shows context specific effects, but generally inhibits adhesion, spreading and proliferation, and promotes collagen matrix formation. For endothelial cells, SPARC disrupts focal adhesions and binds and sequesters PDGF and VEGF[1][2].
The ED50 is <3.0 μg/mL as measured by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells, corresponding to a specific activity of >333 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P09486 (A18-I303)
-
Molecular Construction
-
N-term
-
SPARC (A18-I303)
Accession # P09486 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SPARC; Basement-Membrane Protein 40; Prev. ON; Osteonectin; BM-40; Secreted Protein, Acidic, Cysteine-Rich (Osteonectin); ONT; OI17; Secreted Protein Acidic And Rich In Cysteine; Secreted Protein Acidic And Cysteine Rich; Cysteine-Rich Protein
-
AA Sequence
APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
-
Predicted Molecular Mass
36.1 kDa
-
Molecular Weight
Approximately 36 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Sage H, et al. SPARC, a secreted protein associated with cellular proliferation, inhibits cell spreading in vitro and exhibits Ca+2-dependent binding to the extracellular matrix. J Cell Biol. 1989 Jul;109(1):341-56. [Content Brief]
[2]. Alford AI, et al. Matricellular proteins: Extracellular modulators of bone development, remodeling, and regeneration. Bone. 2006 Jun;38(6):749-57. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
