STC2/Stanniocalcin-2 Protein, Mouse
Based on 1 Customer Validation
The STC2/Stanniocalcin-2 protein exerts anti-hypocalcemia effects and is actively involved in the regulation of calcium and phosphate homeostasis.Its role in maintaining the balance of these essential minerals emphasizes its importance in physiological processes related to mineral metabolism.STC2/Stanniocalcin-2 Protein, Mouse is the recombinant mouse-derived STC2/Stanniocalcin-2 protein, expressed by E.coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The STC2/Stanniocalcin-2 protein exerts anti-hypocalcemia effects and is actively involved in the regulation of calcium and phosphate homeostasis.Its role in maintaining the balance of these essential minerals emphasizes its importance in physiological processes related to mineral metabolism.STC2/Stanniocalcin-2 Protein, Mouse is the recombinant mouse-derived STC2/Stanniocalcin-2 protein, expressed by E.coli , with tag free.
Stanniocalcin-2 (STC2) is a protein with an anti-hypocalcemic action, actively participating in the regulation of calcium and phosphate homeostasis. STC2 forms homodimers through disulfide linkages, emphasizing its structural organization. Its anti-hypocalcemic activity suggests a crucial role in maintaining appropriate levels of calcium and phosphate in the body, highlighting its potential significance in various physiological processes. Further research may delve into the specific molecular pathways through which STC2 modulates calcium and phosphate homeostasis, shedding light on its broader implications for overall systemic balance and its potential relevance in therapeutic contexts related to mineral metabolism.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
O88452 (T25-R296)
-
Molecular Construction
-
N-term
-
STC2 (T25-R296)
Accession # O88452 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
STC2; Stanniocalcin-Related Protein; Stanniocalcin 2; STC-Related Protein; STC-2; STCRP; Stanniocalcin-2
-
AA Sequence
TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR
-
Predicted Molecular Mass
30.1 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
