STC2/Stanniocalcin-2 Protein, Mouse

The STC2/Stanniocalcin-2 protein exerts anti-hypocalcemia effects and is actively involved in the regulation of calcium and phosphate homeostasis. Its role in maintaining the balance of these essential minerals emphasizes its importance in physiological processes related to mineral metabolism. STC2/Stanniocalcin-2 Protein, Mouse is the recombinant mouse-derived STC2/Stanniocalcin-2 protein, expressed by E. coli , with tag free. The total length of STC2/Stanniocalcin-2 Protein, Mouse is 272 a.a., with molecular weight of ~34 kDa.

Stanniocalcin-2 (STC2) is a protein with an anti-hypocalcemic action, actively participating in the regulation of calcium and phosphate homeostasis. STC2 forms homodimers through disulfide linkages, emphasizing its structural organization. Its anti-hypocalcemic activity suggests a crucial role in maintaining appropriate levels of calcium and phosphate in the body, highlighting its potential significance in various physiological processes. Further research may delve into the specific molecular pathways through which STC2 modulates calcium and phosphate homeostasis, shedding light on its broader implications for overall systemic balance and its potential relevance in therapeutic contexts related to mineral metabolism.

Mouse

E. coli

Tag Free

O88452 (25T-296R)

20856  [NCBI]

TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR

Approximately 34 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.