2. Recombinant Proteins
  3. Others
  4. SYT1/Synaptotagmin-1 Protein, Rat (Cell-Free, His)

SYT1/Synaptotagmin-1 Protein, Rat (Cell-Free, His)

Cat. No.: HY-P702463
Handling Instructions

Synaptotagmin-1 protein is a calcium sensor involved in neurotransmitter release and regulates synaptic vesicle transport. It binds acidic phospholipids and interacts with certain proteins, including neurotoxins, syntaxin, and AP2. SYT1/Synaptotagmin-1 Protein, Rat (Cell-Free, His) is the recombinant rat-derived SYT1/Synaptotagmin-1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of SYT1/Synaptotagmin-1 Protein, Rat (Cell-Free, His) is 421 a.a., with molecular weight of 53.5 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Synaptotagmin-1 protein is a calcium sensor involved in neurotransmitter release and regulates synaptic vesicle transport. It binds acidic phospholipids and interacts with certain proteins, including neurotoxins, syntaxin, and AP2. SYT1/Synaptotagmin-1 Protein, Rat (Cell-Free, His) is the recombinant rat-derived SYT1/Synaptotagmin-1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of SYT1/Synaptotagmin-1 Protein, Rat (Cell-Free, His) is 421 a.a., with molecular weight of 53.5 kDa.
Background

SYT1, also known as Synaptotagmin-1, functions as a calcium sensor crucial for initiating neurotransmitter release at the synapse. It may play a regulatory role in membrane interactions during the trafficking of synaptic vesicles at the active zone. SYT1 exhibits a specificity in binding acidic phospholipids, requiring the presence of both an acidic head group and a diacyl backbone. In addition to its Ca(2+)-dependent interaction with putative receptors for activated protein kinase C, SYT1 can bind to neurexins, syntaxin, and AP2 in a Ca(2+)-independent manner. The protein also contributes to dendrite formation by melanocytes and serves as a receptor for C. botulinum neurotoxin type B (BoNT/B), with interaction improvement in the presence of gangliosides. BoNT/B toxin specifically binds to the membrane-proximal vesicular domain of SYT1, emphasizing its role in microbial infection and toxin response.
Species

Rat
Source

E. coli Cell-free
Tag

N-10*His
Accession

P21707 (M1-K421)
Gene ID

25716
Molecular Construction
N-term
10*His
SYT1 (M1-K421)
Accession # P21707
C-term
Synonyms
Synaptotagmin-1; Synaptotagmin I; SytI; p65
AA Sequence

MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

Molecular Weight

53.5 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

SYT1/Synaptotagmin-1 Protein, Rat (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SYT1/Synaptotagmin-1 Protein, Rat (Cell-Free, His)
Cat. No.:
HY-P702463
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.