SYT2/Synaptotagmin-2 Protein, Rat (Cell-Free, His)

The SYT2/Synaptotagmin-2 protein binds to calcium-dependent phospholipids and inositol polyphosphate and regulates synaptic vesicle trafficking at synapses. It contributes to the formation of dendrites in melanocytes and serves as a receptor for botulinum neurotoxin type B (BoNT/B, botB) during microbial infections. SYT2/Synaptotagmin-2 Protein, Rat (Cell-Free, His) is the recombinant rat-derived SYT2/Synaptotagmin-2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of SYT2/Synaptotagmin-2 Protein, Rat (Cell-Free, His) is 422 a.a., with molecular weight of 48.7 kDa.

SYT2/Synaptotagmin-2 protein displays calcium-dependent phospholipid and inositol polyphosphate binding properties, suggesting its involvement in regulating membrane interactions during the trafficking of synaptic vesicles at the active zone of the synapse. Furthermore, SYT2 plays a role in dendrite formation by melanocytes, contributing to cellular morphology. In the context of microbial infection, SYT2 serves as a receptor for C.botulinum neurotoxin type B (BoNT/B, botB). Notably, the interaction between SYT2 and BoNT/B is not enhanced in the presence of gangliosides, distinguishing it from other botulinum neurotoxin receptors. The toxin specifically binds to the vesicular domain of SYT2, emphasizing its functional role in the pathogenic mechanism of BoNT/B. These diverse roles underscore the significance of SYT2 in mediating cellular processes and responding to external signals, both in normal cellular function and in the context of microbial interactions.

Rat

E. coli Cell-free

N-10*His

P29101 (M1-K422)

24805

MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK

48.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.