TAS1R2 Protein, Human (Cell-Free, 273a.a, His)

TAS1R2 Protein, a putative taste receptor, recognizes various natural and synthetic sweeteners as part of a heterodimeric complex with TAS1R3. Crucial for sweetness perception, its ability to respond to diverse sweet compounds underscores its significance in taste sensation. Further studies are needed to unveil comprehensive molecular mechanisms and its contribution to taste perception with different sweet stimuli. TAS1R2 Protein, Human (Cell-Free, 273a.a, His) is the recombinant human-derived TAS1R2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of TAS1R2 Protein, Human (Cell-Free, 273a.a, His) is 273 a.a., with molecular weight of 32.0 kDa.

TAS1R2 is a putative taste receptor known for its role in recognizing a wide range of natural and synthetic sweeteners. Functioning as part of a heterodimeric complex with TAS1R3, it plays a crucial role in the perception of sweetness. The receptor's ability to respond to diverse sweet compounds highlights its significance in the sensory experience of taste. Further studies are required to unveil the comprehensive molecular mechanisms underlying its interaction with various sweet stimuli and its contribution to taste perception.

Human

E. coli Cell-free

N-10*His

Q8TE23 (I567-D839)

80834

IAVALLAALGFLSTLAILVIFWRHFQTPIVRSAGGPMCFLMLTLLLVAYMVVPVYVGPPKVSTCLCRQALFPLCFTICISCIAVRSFQIVCAFKMASRFPRAYSYWVRYQGPYVSMAFITVLKMVIVVIGMLATGLSPTTRTDPDDPKITIVSCNPNYRNSLLFNTSLDLLLSVVGFSFAYMGKELPTNYNEAKFITLSMTFYFTSSVSLCTFMSAYSGVLVTIVDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD

32.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.