TEAD4 Protein, Human (His)
Based on 1 Customer Validation
TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.
Background
TEAD4, a transcription factor, assumes a pivotal role in the Hippo signaling pathway, a regulatory network crucial for organ size control and tumor suppression by orchestrating proliferation inhibition and apoptosis promotion. The pathway's core features a kinase cascade wherein MST1/MST2, in conjunction with its regulatory protein SAV1, phosphorylates and activates LATS1/2 complexed with its regulatory partner MOB1. MOB1 subsequently phosphorylates and inactivates the YAP1 oncoprotein and WWTR1/TAZ. TEAD4 functions by mediating the gene expression of YAP1 and WWTR1/TAZ, thereby overseeing cellular processes such as proliferation, migration, and epithelial-mesenchymal transition (EMT) induction. The protein exhibits specific and non-cooperative binding to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3'), activating transcription, and also interacts with the M-CAT motif. TEAD4's intricate interactions with YAP1 and WWTR1/TAZ underscore its central role in the regulatory dynamics of this signaling pathway.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q15561 (M74-E434)
-
Molecular Construction
-
N-term
-
6*His
-
TEAD4 (M74-E434)
Accession # Q15561 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TEAD4; RTEF1; Prev. TCF13L1; TEA Domain Family Member 4 Isoform 1 Variant; Transcriptional Enhancer Factor TEF-3; Transcriptional Enhancer Factor 1-Related; TEA Domain Family Member 4; TEA Domain Family Member 4, Isoform CRA_b; TEFR-1; Related Transcripti
-
AA Sequence
MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
-
Predicted Molecular Mass
44.7 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HC1, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)