TEAD4 Protein, Human (His)

TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.

TEAD4, a transcription factor, assumes a pivotal role in the Hippo signaling pathway, a regulatory network crucial for organ size control and tumor suppression by orchestrating proliferation inhibition and apoptosis promotion. The pathway's core features a kinase cascade wherein MST1/MST2, in conjunction with its regulatory protein SAV1, phosphorylates and activates LATS1/2 complexed with its regulatory partner MOB1. MOB1 subsequently phosphorylates and inactivates the YAP1 oncoprotein and WWTR1/TAZ. TEAD4 functions by mediating the gene expression of YAP1 and WWTR1/TAZ, thereby overseeing cellular processes such as proliferation, migration, and epithelial-mesenchymal transition (EMT) induction. The protein exhibits specific and non-cooperative binding to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3'), activating transcription, and also interacts with the M-CAT motif. TEAD4's intricate interactions with YAP1 and WWTR1/TAZ underscore its central role in the regulatory dynamics of this signaling pathway.

Human

E. coli

N-6*His

Q15561 (M74-E434)

7004  [NCBI]

Partial

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HC1, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.