TMED9 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

TMED9 is a key player in vesicle protein trafficking and plays an important role in the early secretory pathway, particularly in COPI vesicle-mediated retrograde transport. It promotes the recruitment of coat isoforms to the membrane, enhances ARFGAP2 activity, and ensures the specific retention of p24 complexes in cis-Golgi membranes, specifically affecting TMED2 and TMED10 localization. TMED9 Protein, Human (HEK293, His) is the recombinant human-derived TMED9 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TMED9 is a key player in vesicle protein trafficking and plays an important role in the early secretory pathway, particularly in COPI vesicle-mediated retrograde transport. It promotes the recruitment of coat isoforms to the membrane, enhances ARFGAP2 activity, and ensures the specific retention of p24 complexes in cis-Golgi membranes, specifically affecting TMED2 and TMED10 localization. TMED9 Protein, Human (HEK293, His) is the recombinant human-derived TMED9 protein, expressed by HEK293 , with C-His labeled tag.

Background

TMED9, a protein intricately involved in vesicular protein trafficking, predominantly operates within the early secretory pathway, particularly in COPI vesicle-mediated retrograde transport, facilitating coatomer recruitment to membranes. It enhances the coatomer-dependent activity of ARFGAP2 and plays a pivotal role in the specific retention of p24 complexes in cis-Golgi membranes, contributing notably to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. Beyond its involvement in retrograde transport, TMED9 is implicated in the organization of intracellular membranes, including the ER-Golgi intermediate compartment and the Golgi apparatus. It further participates in the ER localization of PTPN2 isoform PTPB. TMED9 exhibits a dynamic oligomeric state, existing as a monomer and homodimer in the endoplasmic reticulum, with a predominantly monomeric state in the endoplasmic reticulum-Golgi intermediate compartment and cis-Golgi network. Oligomerization likely occurs with other members of the EMP24/GP25L family, such as TMED2, TMED7, and TMED10. Additionally, TMED9 engages in specific interactions with TMED5, COPG1, PTPN2, SPAST, and STX17, underscoring its multifaceted involvement in intracellular processes.

Verified Bioactivity

Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is 19.86 ng/mL. Corresponding to a specific activity is 5.035×104 Unit/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TMED9 (L38-R202)
      Accession # Q9BVK6/NP_059980.2
    • His
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    TMED9; Transmembrane Emp24 Domain-Containing Protein 9; Transmembrane P24 Trafficking Protein 9; P24 Family Protein Alpha-2; P24alpha2; Glycoprotein 25L2; HSGP25L2G; GMP25; P24a2; P25; Transmembrane Emp24 Protein Transport Domain Containing 9; GP25L2

  • AA Sequence

    LYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQR

  • Predicted Molecular Mass

    19.4 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00