TMED9 Protein, Human (HEK293, His)
Based on 1 Customer Validation
TMED9 is a key player in vesicle protein trafficking and plays an important role in the early secretory pathway, particularly in COPI vesicle-mediated retrograde transport. It promotes the recruitment of coat isoforms to the membrane, enhances ARFGAP2 activity, and ensures the specific retention of p24 complexes in cis-Golgi membranes, specifically affecting TMED2 and TMED10 localization. TMED9 Protein, Human (HEK293, His) is the recombinant human-derived TMED9 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TMED9 is a key player in vesicle protein trafficking and plays an important role in the early secretory pathway, particularly in COPI vesicle-mediated retrograde transport. It promotes the recruitment of coat isoforms to the membrane, enhances ARFGAP2 activity, and ensures the specific retention of p24 complexes in cis-Golgi membranes, specifically affecting TMED2 and TMED10 localization. TMED9 Protein, Human (HEK293, His) is the recombinant human-derived TMED9 protein, expressed by HEK293 , with C-His labeled tag.
Background
TMED9, a protein intricately involved in vesicular protein trafficking, predominantly operates within the early secretory pathway, particularly in COPI vesicle-mediated retrograde transport, facilitating coatomer recruitment to membranes. It enhances the coatomer-dependent activity of ARFGAP2 and plays a pivotal role in the specific retention of p24 complexes in cis-Golgi membranes, contributing notably to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. Beyond its involvement in retrograde transport, TMED9 is implicated in the organization of intracellular membranes, including the ER-Golgi intermediate compartment and the Golgi apparatus. It further participates in the ER localization of PTPN2 isoform PTPB. TMED9 exhibits a dynamic oligomeric state, existing as a monomer and homodimer in the endoplasmic reticulum, with a predominantly monomeric state in the endoplasmic reticulum-Golgi intermediate compartment and cis-Golgi network. Oligomerization likely occurs with other members of the EMP24/GP25L family, such as TMED2, TMED7, and TMED10. Additionally, TMED9 engages in specific interactions with TMED5, COPG1, PTPN2, SPAST, and STX17, underscoring its multifaceted involvement in intracellular processes.
Verified Bioactivity
Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is 19.86 ng/mL. Corresponding to a specific activity is 5.035×104 Unit/mg.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q9BVK6/NP_059980.2 (L38-R202)
-
Molecular Construction
-
N-term
-
TMED9 (L38-R202)
Accession # Q9BVK6/NP_059980.2 -
His
-
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
TMED9; Transmembrane Emp24 Domain-Containing Protein 9; Transmembrane P24 Trafficking Protein 9; P24 Family Protein Alpha-2; P24alpha2; Glycoprotein 25L2; HSGP25L2G; GMP25; P24a2; P25; Transmembrane Emp24 Protein Transport Domain Containing 9; GP25L2
-
AA Sequence
LYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQR
-
Predicted Molecular Mass
19.4 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)