1. Recombinant Proteins
  2. Others
  3. TMIGD2 Protein, Human (HEK293, His)

TMIGD2 Protein, Human (HEK293, His)

Cat. No.: HY-P71370
Handling Instructions

TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TMIGD2 Protein, Human (HEK293, His) is 128 a.a., with molecular weight of ~30.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TMIGD2 Protein, Human (HEK293, His) is 128 a.a., with molecular weight of ~30.0 kDa.

Background

TMIGD2, a multifaceted protein, actively participates in various cellular processes such as cell-cell interaction, cell migration, and angiogenesis. Its interaction with HHLA2 highlights its role in costimulating T-cells during TCR-mediated activation, thereby enhancing T-cell proliferation and cytokine production through an AKT-dependent signaling cascade. TMIGD2 may also engage in homophilic interactions, potentially regulating cell-cell communication. Additionally, it forms interactions with CACNB2, DST, MIA, and NCKIPSD, indicating its involvement in diverse cellular pathways and signaling networks. These interactions collectively underscore the versatile functions of TMIGD2 in orchestrating essential cellular activities.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96BF3 (L23-G150)

Gene ID
Molecular Construction
N-term
TMIGD2 (L23-G150)
Accession # Q96BF3
6*His
C-term
Synonyms
Transmembrane and immunoglobulin domain-containing protein 2; Immunoglobulin and proline-rich receptor 1; IGPR1; TMIGD2
AA Sequence

LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

Molecular Weight

Approximately 30.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TMIGD2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMIGD2 Protein, Human (HEK293, His)
Cat. No.:
HY-P71370
Quantity:
MCE Japan Authorized Agent: