TMIGD2 Protein, Human (HEK293, His)
TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
TMIGD2, a multifaceted protein, actively participates in various cellular processes such as cell-cell interaction, cell migration, and angiogenesis. Its interaction with HHLA2 highlights its role in costimulating T-cells during TCR-mediated activation, thereby enhancing T-cell proliferation and cytokine production through an AKT-dependent signaling cascade. TMIGD2 may also engage in homophilic interactions, potentially regulating cell-cell communication. Additionally, it forms interactions with CACNB2, DST, MIA, and NCKIPSD, indicating its involvement in diverse cellular pathways and signaling networks. These interactions collectively underscore the versatile functions of TMIGD2 in orchestrating essential cellular activities.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q96BF3-1 (L23-G150)
-
Molecular Construction
-
N-term
-
TMIGD2 (L23-G150)
Accession # Q96BF3-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TMIGD2; CD28 Homologue; Transmembrane And Immunoglobulin Domain Containing 2; CD28 Homolog; IGPR-1; MGC23244; CD28H; IGPR1; Transmembrane And Immunoglobulin Domain-Containing Protein 2; Immunoglobulin-Containing And Proline-Rich Receptor-1; Immunoglobulin
-
AA Sequence
LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG
-
Predicted Molecular Mass
15.1 kDa
-
Molecular Weight
Approximately 20-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
