1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily Neurotrophic Factors
  4. TNF Superfamily Ligands
  5. TNF-alpha
  6. TNF-alpha/TNFSF2 Protein, Guinea (N-His)

TNF-alpha/TNFSF2 Protein, Guinea (N-His)

Cat. No.: HY-P79165A
COA Handling Instructions

TNF-alpha/TNFSF2 protein binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing cell death in specific tumors and causing fever. It can also stimulate cell proliferation, induce insulin resistance, promote angiogenesis, and mediate bone resorption. TNF-alpha's intracellular domain induces IL12 production, highlighting its diverse physiological impact. TNF-alpha/TNFSF2 Protein, Guinea (N-His) is the recombinant TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of TNF-alpha/TNFSF2 Protein, Guinea (N-His) is 156 a.a., with molecular weight of ~19 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $95 In-stock
10 μg $160 In-stock
50 μg $450 In-stock
100 μg $765 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNF-alpha/TNFSF2 protein binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing cell death in specific tumors and causing fever. It can also stimulate cell proliferation, induce insulin resistance, promote angiogenesis, and mediate bone resorption. TNF-alpha's intracellular domain induces IL12 production, highlighting its diverse physiological impact. TNF-alpha/TNFSF2 Protein, Guinea (N-His) is the recombinant TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of TNF-alpha/TNFSF2 Protein, Guinea (N-His) is 156 a.a., with molecular weight of ~19 kDa.

Background

TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Predominantly secreted by macrophages, it possesses the ability to induce cell death in specific tumor cell lines and serves as a potent pyrogen, causing fever through direct action or by stimulating interleukin-1 secretion. TNF-alpha is implicated in the induction of cachexia, and under certain conditions, it can stimulate cell proliferation and induce cell differentiation. Moreover, it induces insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake, contributing to GKAP42 protein degradation in adipocytes and, consequently, TNF-induced insulin resistance. Beyond its metabolic effects, TNF-alpha plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6. Additionally, it promotes osteoclastogenesis, mediating bone resorption, and its intracellular domain (ICD) form induces IL12 production in dendritic cells, underscoring its multifaceted impact on diverse physiological processes.

Biological Activity

Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 this effect is 0.04334 ng/mL, corresponding to a specific activity is 2.307×107units/mg.

  • Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 0.04334 ng/mL, corresponding to a specific activity is 2.307×107 units/mg.
Species

Others

Source

E. coli

Tag

N-6*His

Accession

P51435 (L79-L234)

Gene ID

100135630  [NCBI]

Molecular Construction
N-term
6*His
TGF-α (L79-L234)
Accession # P51435
C-term
Synonyms
DIF; TNF-alpha; TNFA; TNFSF2; cachexin; cachectin; TNFα; Tumor Necrosis Factor alpha
AA Sequence

LRSASQNDNDKPVAHVVANQQAEEELQWLSKRANALLANGMGLSDNQLVVPSDGLYLIYSQVLFKGQGCPSYLLLTHTVSRLAVSYPEKVNLLSAIKSPCQKETPEGAERKPWYEPIYLGGVFQLQKGDRLSAEVNLPQYLDFADSGQIYFGVIAL

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-alpha/TNFSF2 Protein, Guinea (N-His)
Cat. No.:
HY-P79165A
Quantity:
MCE Japan Authorized Agent: