TNF-alpha/TNFSF2 Protein, Marmota monax (Baculovirus, His)

TNF-α/TNFSF2 protein is a cytokine secreted by macrophages that binds TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It induces tumor cell death, acts as a potent pyrogen causing fever, and is associated with cachexia induction. TNF-alpha/TNFSF2 Protein, Marmota monax (Baculovirus, His) is the recombinant TNF-alpha/TNFSF2 protein, expressed by Sf9 insect cells , with N-10*His labeled tag. The total length of TNF-alpha/TNFSF2 Protein, Marmota monax (Baculovirus, His) is 177 a.a., with molecular weight of 22.2 kDa.

TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Mainly secreted by macrophages, it possesses the capability to induce cell death in specific tumor cell lines and functions as a potent pyrogen, causing fever through direct action or by stimulating interleukin-1 secretion. Implicated in the induction of cachexia, TNF-alpha exhibits diverse roles; under certain conditions, it can stimulate cell proliferation and induce cell differentiation. Additionally, it induces insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake, contributing to GKAP42 protein degradation and TNF-induced insulin resistance. TNF-alpha plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6, and it promotes osteoclastogenesis, mediating bone resorption. The intracellular domain (ICD) form of TNF-alpha induces IL12 production in dendritic cells, highlighting its multifaceted impact across various physiological processes.

Others

Sf9 insect cells

N-10*His

O35734 (G57-L233)

124109351  [NCBI]

GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL

22.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.