2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. TNF Superfamily Neurotrophic Factors
  5. TNF Superfamily Ligands
  6. TNF-alpha
  7. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His)

TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His)

Cat. No.: HY-P700516
Handling Instructions

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is 157 a.a., with molecular weight of 19.2 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is 157 a.a., with molecular weight of 19.2 kDa.
Background

TNF-alpha/TNFSF2 Protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is primarily secreted by macrophages and has multiple biological activities. It can induce cell death in certain tumor cell lines and acts as a potent pyrogen, causing fever either through direct action or by stimulating interleukin-1 secretion. TNF-alpha/TNFSF2 Protein is also implicated in the induction of cachexia. Under specific conditions, it can stimulate cell proliferation and promote cell differentiation. Additionally, it induces insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, while also leading to GKAP42 protein degradation, which contributes to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6. Moreover, it facilitates osteoclastogenesis and, consequently, mediates bone resorption. Lastly, the TNF intracellular domain (ICD) form of TNF-alpha/TNFSF2 Protein stimulates IL12 production in dendritic cells.
Species

Sheep
Source

P. pastoris
Tag

N-6*His
Accession

P23383 (L78-L234)
Gene ID

443540  [NCBI]
Molecular Construction
N-term
6*His
TGF-α (L78-L234)
Accession # P23383
C-term
Synonyms
rHuTNF-α, His; Cachectin; TNFSF2
AA Sequence

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Molecular Weight

19.2 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His)
Cat. No.:
HY-P700516
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.