1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Lymphotoxin β Receptor
  6. TNFRSF3/LTBR Protein, Human (HEK293, His)

TNFRSF3/LTBR Protein, Human (HEK293, His)

Cat. No.: HY-P70345
COA Handling Instructions

TNFRSF3/LTBR Protein, Human (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a His tag at the C-terminus.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $72 In-stock
Estimated Time of Arrival: December 31
50 μg $168 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TNFRSF3/LTBR Protein, Human (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a His tag at the C-terminus[1].

Background

Lymphotoxin beta receptor (LTBR), also known as tumor necrosis factor receptor superfamily member 3 (TNFRSF3), is a member of the tumor necrosis factor receptor superfamily and a cell surface receptor for lymphotoxins involved in apoptosis and cytokine release. LTBR is expressed on the surface of most cell types, including breast, colorectal, lung, gastric, melanoma, and bladder cancers , while its ligands lymphotoxin (LT) a1b2 and TNF superfamily member 14 (TNFSF14; also known as LIGHT), are mainly expressed on the surface of immune cells. The LTBR signaling pathway may be involved in the activation of responses that control cell differentiation, growth and death, as manifested by the formation of peripheral lymphoid-like organs, especially secondary and tertiary lymphoid structures critical for tissue, dendritic cell homeostasis, liver regeneration, interferon response to pathogens and death in mucosa-derived carcinomas. LTβR signaling may facilitate communication between infiltrating immune cells and tumor cells. Triggering LTβR induces typical and atypical nuclear factor (NF)-κB signaling pathways that are associated with inflammation-induced oncogenic effects. Sustained LTβR signaling also leads to NF-κB-mediated chronic inflammation and the development of hepatocellular carcinoma (HCC)[1][2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P36941 (Q31-M227)

Gene ID
Synonyms
rHuTumor necrosis factor receptor superfamily member 3/TNFRSF3, His; Tumor Necrosis Factor Receptor Superfamily Member 3; Lymphotoxin-Beta Receptor; Tumor Necrosis Factor C Receptor; Tumor Necrosis Factor Receptor 2-Related Protein; Tumor Necrosis Factor Receptor Type III; TNF-RIII; TNFR-III; LTBR; D12S370; TNFCR; TNFR3; TNFRSF3
AA Sequence

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Molecular Weight

29-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

TNFRSF3/LTBR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF3/LTBR Protein, Human (HEK293, His)
Cat. No.:
HY-P70345
Quantity:
MCE Japan Authorized Agent: