TRIM21 Protein, Mouse (His-SUMO)

Customer Review

Based on 1 Customer Validation

TRIM21 is an E3 ubiquitin protein ligase that forms complexes with E2 enzymes including UBE2D1 and UBE2E2.It cooperates with UBE2D2 to ubiquitinate USP4, IKBKB and itself, and binds to SCF E3 ligase to mediate ubiquitination of CDKN1B.TRIM21 Protein, Mouse (His-SUMO) is the recombinant mouse-derived TRIM21 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TRIM21 is an E3 ubiquitin protein ligase that forms complexes with E2 enzymes including UBE2D1 and UBE2E2.It cooperates with UBE2D2 to ubiquitinate USP4, IKBKB and itself, and binds to SCF E3 ligase to mediate ubiquitination of CDKN1B.TRIM21 Protein, Mouse (His-SUMO) is the recombinant mouse-derived TRIM21 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Background

TRIM21 Protein functions as an E3 ubiquitin-protein ligase, relying on E2 enzymes (UBE2D1, UBE2D2, UBE2E1, UBE2E2). It forms a ubiquitin ligase complex with UBE2D2, ubiquitinating USP4, IKBKB, and itself. Associated with cullin-RING-based SCF E3 ligase complexes, it mediates CDKN1B ubiquitination and participates in the negative regulation of Tax-induced NF-kappa-B signaling. TRIM21 negatively regulates IFN-beta production and mediates ubiquitin-mediated degradation of IgG1 heavy chain. It promotes IRF8 ubiquitination, influences cell cycle progression, enhances DCP2 decapping activity, and plays a role in autophagy regulation. Additionally, TRIM21 is involved in innate immunity, inflammatory responses, and antiviral defense, mediating ubiquitination events that impact cellular processes.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • TRIM21 (M1-M470)
      Accession # Q62191
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    TRIM21; RING Finger Protein 81; Tripartite Motif Containing 21; 52 KDa Ro Protein; SSA1; Ro/SSA 52kDa; RNF81; Ro(SS-A); SS-A; RO52; E3 Ubiquitin-Protein Ligase TRIM21; RING-Type E3 Ubiquitin Transferase TRIM21; Sjogren Syndrome Antigen A1 (52kDa, Ribonucleoprotein Autoantigen SS-A/Ro); Tripartite Motif-Containing 21; 52 KDa Ribonucleoprotein Autoantigen Ro/SS-A; Tripartite Motif-Containing Protein 21; Sjoegren Syndrome Type A Antigen; Sicca Syndrome Antigen A; Ro/SSA; SSA

  • AA Sequence

    MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM

  • Predicted Molecular Mass

    67.1 kDa

  • Molecular Weight

    Approximately 67 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00