TRIM21 Protein, Mouse (His-SUMO)
Based on 1 Customer Validation
TRIM21 is an E3 ubiquitin protein ligase that forms complexes with E2 enzymes including UBE2D1 and UBE2E2.It cooperates with UBE2D2 to ubiquitinate USP4, IKBKB and itself, and binds to SCF E3 ligase to mediate ubiquitination of CDKN1B.TRIM21 Protein, Mouse (His-SUMO) is the recombinant mouse-derived TRIM21 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TRIM21 is an E3 ubiquitin protein ligase that forms complexes with E2 enzymes including UBE2D1 and UBE2E2.It cooperates with UBE2D2 to ubiquitinate USP4, IKBKB and itself, and binds to SCF E3 ligase to mediate ubiquitination of CDKN1B.TRIM21 Protein, Mouse (His-SUMO) is the recombinant mouse-derived TRIM21 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
TRIM21 Protein functions as an E3 ubiquitin-protein ligase, relying on E2 enzymes (UBE2D1, UBE2D2, UBE2E1, UBE2E2). It forms a ubiquitin ligase complex with UBE2D2, ubiquitinating USP4, IKBKB, and itself. Associated with cullin-RING-based SCF E3 ligase complexes, it mediates CDKN1B ubiquitination and participates in the negative regulation of Tax-induced NF-kappa-B signaling. TRIM21 negatively regulates IFN-beta production and mediates ubiquitin-mediated degradation of IgG1 heavy chain. It promotes IRF8 ubiquitination, influences cell cycle progression, enhances DCP2 decapping activity, and plays a role in autophagy regulation. Additionally, TRIM21 is involved in innate immunity, inflammatory responses, and antiviral defense, mediating ubiquitination events that impact cellular processes.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q62191 (M1-M470)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
TRIM21 (M1-M470)
Accession # Q62191 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TRIM21; RING Finger Protein 81; Tripartite Motif Containing 21; 52 KDa Ro Protein; SSA1; Ro/SSA 52kDa; RNF81; Ro(SS-A); SS-A; RO52; E3 Ubiquitin-Protein Ligase TRIM21; RING-Type E3 Ubiquitin Transferase TRIM21; Sjogren Syndrome Antigen A1 (52kDa, Ribonucl
-
AA Sequence
MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM
-
Predicted Molecular Mass
70.2 kDa
-
Molecular Weight
Approximately 70 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
