TRIM21 Protein, Mouse (His-SUMO)

TRIM21 is an E3 ubiquitin protein ligase that forms complexes with E2 enzymes including UBE2D1 and UBE2E2. It cooperates with UBE2D2 to ubiquitinate USP4, IKBKB and itself, and binds to SCF E3 ligase to mediate ubiquitination of CDKN1B. TRIM21 Protein, Mouse (His-SUMO) is the recombinant mouse-derived TRIM21 protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of TRIM21 Protein, Mouse (His-SUMO) is 470 a.a., with molecular weight of ~70.2 kDa.

TRIM21 Protein functions as an E3 ubiquitin-protein ligase, relying on E2 enzymes (UBE2D1, UBE2D2, UBE2E1, UBE2E2). It forms a ubiquitin ligase complex with UBE2D2, ubiquitinating USP4, IKBKB, and itself. Associated with cullin-RING-based SCF E3 ligase complexes, it mediates CDKN1B ubiquitination and participates in the negative regulation of Tax-induced NF-kappa-B signaling. TRIM21 negatively regulates IFN-beta production and mediates ubiquitin-mediated degradation of IgG1 heavy chain. It promotes IRF8 ubiquitination, influences cell cycle progression, enhances DCP2 decapping activity, and plays a role in autophagy regulation. Additionally, TRIM21 is involved in innate immunity, inflammatory responses, and antiviral defense, mediating ubiquitination events that impact cellular processes.

Mouse

E. coli

N-His;N-SUMO

Q62191 (1M-470M)

20821  [NCBI]

MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM

Approximately 70.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in Tris-based buffer, 50% glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.