VEGF-C Protein, Mouse/Rat (HEK293, His)

VEGF-C protein stimulates cell proliferation, migration, and vascular permeability, which are critical for angiogenesis and endothelial cell dynamics. It plays a crucial role in the development of the venous and lymphatic vasculature during embryogenesis and in the maintenance of adult lymphatic endothelium. VEGF-C Protein, Mouse/Rat (HEK293, His) is the recombinant mouse, rat-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag.

VEGF-CC, a growth factor crucial in angiogenesis and endothelial cell dynamics, exerts stimulatory effects on cellular proliferation and migration, while also influencing the permeability of blood vessels. It plays a vital role in angiogenesis, particularly in the development of the venous and lymphatic vascular systems during embryogenesis. Additionally, VEGF-CC contributes to the maintenance of differentiated lymphatic endothelium in adults. The protein binds and activates the KDR/VEGFR2 and FLT4/VEGFR3 receptors, orchestrating essential signaling pathways for vascular development and homeostasis. Structurally, VEGF-CC forms a homodimer with a non-covalent and antiparallel arrangement. Its interaction with FLT4/VEGFR3 is imperative for FLT4/VEGFR3 homodimerization and subsequent activation, highlighting the intricacies of its regulatory role in vascular processes.

1. Immobilized mouse/rat VEGFC-His at 10 μg/mL (100 μL/well) can bind mouse VEGFR3-Fc, The EC₅₀ of mouse VEGFR3-Fc is 17.4-40.6 ng/mL.
2. Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC).The ED₅₀ for this effect is typically 0.1-2.7 μg/mL.

• 
  Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ this effect is 1.04 μg/mL, corresponding to a specific activity is 961.54 units/mg.

Mouse; Rat

HEK293

C-6*His

P97953-1/NP_033532.1/O35757 (A108-R223)

22341  [NCBI]/22341  [NCBI]/114111

Partial

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Approximately 18-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.