1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-C
  6. VEGF-CC Protein, Mouse/Rat (HEK293, His)

VEGF-CC Protein, Mouse/Rat (HEK293, His)

Cat. No.: HY-P74474
COA Handling Instructions

VEGF-CC protein stimulates cell proliferation, migration, and vascular permeability, which are critical for angiogenesis and endothelial cell dynamics. It plays a crucial role in the development of the venous and lymphatic vasculature during embryogenesis and in the maintenance of adult lymphatic endothelium. VEGF-CC Protein, Mouse/Rat (HEK293, His) is the recombinant mouse, rat-derived VEGF-CC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF-CC Protein, Mouse/Rat (HEK293, His) is 116 a.a., with molecular weight of 14-23 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $37 In-stock
10 μg $105 In-stock
20 μg $160 In-stock
50 μg $290 In-stock
100 μg $500 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VEGF-CC protein stimulates cell proliferation, migration, and vascular permeability, which are critical for angiogenesis and endothelial cell dynamics. It plays a crucial role in the development of the venous and lymphatic vasculature during embryogenesis and in the maintenance of adult lymphatic endothelium. VEGF-CC Protein, Mouse/Rat (HEK293, His) is the recombinant mouse, rat-derived VEGF-CC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF-CC Protein, Mouse/Rat (HEK293, His) is 116 a.a., with molecular weight of 14-23 kDa.

Background

VEGF-CC, a growth factor crucial in angiogenesis and endothelial cell dynamics, exerts stimulatory effects on cellular proliferation and migration, while also influencing the permeability of blood vessels. It plays a vital role in angiogenesis, particularly in the development of the venous and lymphatic vascular systems during embryogenesis. Additionally, VEGF-CC contributes to the maintenance of differentiated lymphatic endothelium in adults. The protein binds and activates the KDR/VEGFR2 and FLT4/VEGFR3 receptors, orchestrating essential signaling pathways for vascular development and homeostasis. Structurally, VEGF-CC forms a homodimer with a non-covalent and antiparallel arrangement. Its interaction with FLT4/VEGFR3 is imperative for FLT4/VEGFR3 homodimerization and subsequent activation, highlighting the intricacies of its regulatory role in vascular processes.

Biological Activity

1. Immobilized mouse/rat VEGFC-His at 10 μg/mL (100 μL/well) can bind mouse VEGFR3-Fc, The EC50 of mouse VEGFR3-Fc is 17.4-40.6 ng/mL.
2. Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC).The ED50 for this effect is typically 0.1-2.612 μg/mL, corresponding to a specific activity of ≥ 382.85 units/mg.

  • Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is 1.04 μg/mL, corresponding to a specific activity is 961.54 units/mg.
Species

Mouse; Rat

Source

HEK293

Tag

C-6*His

Accession

P97953/NP_033532.1/O35757 (A108-R223)

Gene ID

22341  [NCBI]/22341  [NCBI]/114111

Molecular Construction
N-term
VEGF-CC (A108-R223)
Accession # P97953/NP_033532.1/O35757
6*His
C-term
Synonyms
Flt4-L; vascular endothelial growth factor C; VEGFC; VRP
AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Weight

14-23 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VEGF-CC Protein, Mouse/Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF-CC Protein, Mouse/Rat (HEK293, His)
Cat. No.:
HY-P74474
Quantity:
MCE Japan Authorized Agent: