VEGF-C Protein, Mouse/Rat (HEK293, His)

1. Immobilized mouse/rat VEGFC-His at 10 μg/mL (100 μL/well) can bind mouse VEGFR3-Fc, The EC₅₀ of mouse VEGFR3-Fc is 17.4-40.6 ng/mL.
2. Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC).The ED₅₀ for this effect is typically 0.1-2.612 μg/mL, corresponding to a specific activity of > 382.85 units/mg.

Mouse

HEK293

C-6*His

NP_033532.1/O35757/P97953 (A108-R223)

22341  [NCBI]

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

14-23 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.