VEGF-DD Protein, Rat (HEK293, Fc)

VEGF-DD, a growth factor, stimulates proliferation, migration, and vessel permeability. It is crucial for vascular development and maintenance of lymphatic endothelium. VEGF-DD binds and activates VEGFR-3, initiating essential signaling pathways. Structurally, it forms a non-covalent homodimer, playing an intricate role in vascular processes. VEGF-DD Protein, Rat (HEK293, Fc) is the recombinant rat-derived VEGF-DD protein, expressed by HEK293 , with N-hFc labeled tag. The total length of VEGF-DD Protein, Rat (HEK293, Fc) is 117 a.a., with molecular weight of ~50 kDa.

VEGF-DD, a growth factor with pivotal roles in angiogenesis, lymphangiogenesis, and endothelial cell dynamics, demonstrates the ability to stimulate cellular proliferation and migration, along with influencing blood vessel permeability. Its significance extends to the formation of both venous and lymphatic vascular systems during embryogenesis, as well as the maintenance of differentiated lymphatic endothelium in adults. Functionally, VEGF-DD binds to and activates the VEGFR-3 (Flt4) receptor, initiating crucial signaling pathways for vascular development and homeostasis. Structurally, VEGF-DD exists as a homodimer with a non-covalent and antiparallel configuration, emphasizing its intricate role in orchestrating complex vascular processes.

Measured by its binding ability in a functional ELISA. Immobilized recombinant Rat VEGF-DD at 10 μg/mL (100 μL/well) can bind biotinylated Mouse VEGFR-3. The ED₅₀ for this effect is 312.9 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized recombinant Rat VEGF-DD at 10 μg/mL (100 μL/well) can bind biotinylated Mouse VEGFR-3 .The ED₅₀ for this effect is 312.9 ng/mL.

Rat

HEK293

N-hFc

O35251 (F94-R210)

360457  [NCBI]

FAATFYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEESVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYSIIRR

Approximately 50 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.