XCL1 Protein, Rat (His)
Based on 1 Customer Validation
XCL1 protein attracts lymphocytes but not monocytes or neutrophils. It plays a crucial role in accumulating dendritic cells in the thymus medulla and contributes to regulatory T cell development, establishing self-tolerance. XCL1 Protein, Rat (His) is the recombinant rat-derived XCL1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
XCL1 protein attracts lymphocytes but not monocytes or neutrophils. It plays a crucial role in accumulating dendritic cells in the thymus medulla and contributes to regulatory T cell development, establishing self-tolerance. XCL1 Protein, Rat (His) is the recombinant rat-derived XCL1 protein, expressed by E. coli , with N-6*His labeled tag.
XCL1 protein exhibits chemotactic activity specifically for lymphocytes while not attracting monocytes or neutrophils. In the thymus, it plays a crucial role in mediating the accumulation of dendritic cells in the medulla and contributes to the development of regulatory T cells, thus playing a vital role in establishing self-tolerance.
Measured by its ability to chemoattract Jurkat cells. The ED50 this effect is 27.03 ng/mL, corresponding to a specific activity is 3.70×104 units/mg.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-6*His
-
Accession
P51672 (V22-G114)
-
Molecular Construction
-
N-term
-
6*His
-
XCL1 (V22-G114)
Accession # P51672 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
XCL1; X‑C Motif Chemokine Ligand 1; SCYC1; LTN; ATAC; Lymphotactin; SCM‑1a; SCM‑1; LPTN; Small Inducible Cytokine Subfamily C, Member 1 (Lymphotactin); Chemokine (C Motif) Ligand 1; Small‑Inducible Cytokine C1; XC Chemokine Ligand 1; C Motif Chemokine 1;
-
AA Sequence
VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG
-
Predicted Molecular Mass
10.1 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
