XCL1 Protein, Rat (His)

XCL1 protein attracts lymphocytes but not monocytes or neutrophils. It plays a crucial role in accumulating dendritic cells in the thymus medulla and contributes to regulatory T cell development, establishing self-tolerance. XCL1 Protein, Rat (His) is the recombinant rat-derived XCL1 protein, expressed by E. coli , with N-6*His labeled tag.

XCL1 protein exhibits chemotactic activity specifically for lymphocytes while not attracting monocytes or neutrophils. In the thymus, it plays a crucial role in mediating the accumulation of dendritic cells in the medulla and contributes to the development of regulatory T cells, thus playing a vital role in establishing self-tolerance.

Measured by its ability to chemoattract Jurkat cells. The ED₅₀ this effect is 27.03 ng/mL, corresponding to a specific activity is 3.70×10⁴ units/mg.

• 
  Measured by its ability to chemoattract Jurkat cells. The ED₅₀ for this effect is 27.03 ng/mL, corresponding to a specific activity is 3.70×10⁴ units/mg.

Rat

E. coli

N-6*His

P51672 (V22-G114)

171371  [NCBI]

Full Length of Mature Protein

VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.