XPNPEP3 Protein, Human (His)
The XPNPEP3 protein catalyzes the removal of prolyl residues from N-terminal peptides (such as Leu-Pro-Ala) and has low activity towards Ala or Ser at the P1 site. XPNPEP3 Protein, Human (His) is the recombinant human-derived XPNPEP3 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The XPNPEP3 protein catalyzes the removal of prolyl residues from N-terminal peptides (such as Leu-Pro-Ala) and has low activity towards Ala or Ser at the P1 site. XPNPEP3 Protein, Human (His) is the recombinant human-derived XPNPEP3 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
Background
The XPNPEP3 protein serves a crucial role in peptide processing by catalyzing the removal of a penultimate prolyl residue from the N-termini of peptides, exemplified by substrates like Leu-Pro-Ala. Additionally, it exhibits low activity towards peptides featuring Ala or Ser at the P1 position. Beyond its peptidase function, XPNPEP3 demonstrates an intriguing role as it promotes TNFRSF1B-mediated phosphorylation of MAPK8/JNK1 and MAPK9/JNK2, indicating a potential function as an adapter protein for TNFRSF1B. Notably, this effect is independent of XPNPEP3's peptidase activity, suggesting a dual role in cellular signaling pathways. Furthermore, XPNPEP3 may play a role in inhibiting apoptotic cell death induced via TNF-TNFRSF1B signaling, underlining its involvement in cellular processes beyond peptide cleavage.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;C-6*His
-
Accession
Q9NQH7 (M1-S507)
-
Molecular Construction
-
N-term
-
6*His
-
XPNPEP3 (M1-S507)
Accession # Q9NQH7 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
XPNPEP3; X-Prolyl Aminopeptidase 3; APP3; NPHPL1; ICP55; X-Prolyl Aminopeptidase 3; Mitochondrial; Intermediate Cleaving Peptidase 55; Xaa-Pro Aminopeptidase 3; X-Pro Aminopeptidase 3; X-Prolyl Aminopeptidase (Aminopeptidase P) 3; Putative; Probable Xaa-Pro Amino
-
AA Sequence
MPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSQAS
-
Predicted Molecular Mass
60.2 kDa
-
Molecular Weight
Approximately 65 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
