XPNPEP3 Protein, Human (His)

The XPNPEP3 protein catalyzes the removal of prolyl residues from N-terminal peptides (such as Leu-Pro-Ala) and has low activity towards Ala or Ser at the P1 site. XPNPEP3 Protein, Human (His) is the recombinant human-derived XPNPEP3 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of XPNPEP3 Protein, Human (His) is 507 a.a., with molecular weight of ~65.0 kDa.

The XPNPEP3 protein serves a crucial role in peptide processing by catalyzing the removal of a penultimate prolyl residue from the N-termini of peptides, exemplified by substrates like Leu-Pro-Ala. Additionally, it exhibits low activity towards peptides featuring Ala or Ser at the P1 position. Beyond its peptidase function, XPNPEP3 demonstrates an intriguing role as it promotes TNFRSF1B-mediated phosphorylation of MAPK8/JNK1 and MAPK9/JNK2, indicating a potential function as an adapter protein for TNFRSF1B. Notably, this effect is independent of XPNPEP3's peptidase activity, suggesting a dual role in cellular signaling pathways. Furthermore, XPNPEP3 may play a role in inhibiting apoptotic cell death induced via TNF-TNFRSF1B signaling, underlining its involvement in cellular processes beyond peptide cleavage.

Human

E. coli

N-6*His;C-6*His

Q9NQH7 (M1-S507)

63929  [NCBI]

MPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSQAS

Approximately 65.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.