Amylin, amide, rat
Based on 1 publication(s) in Google Scholar
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
For research use only. We do not sell to patients.
- Purity: 99.99%
- CAS No.: 124447-81-0
- Formula: C167H272N52O53S2
- Molecular Weight:3920.44
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) Amylin, amide, rat
More
Biological Activity
Amylin receptor AMY1 and AMY3[1]
Amylin is an important, but poorly understood, 37 amino acid glucoregulatory hormone with great potential to target metabolic diseases. Amylin is a member of the calcitonin (CT) family of peptides, which includes CT itself, the CGRPs comprising two variants (αCGRP and βCGRP), adrenomedullin (AM) and AM2 (intermedin). Amylin is a centrally acting, neuroendocrine hormone synthesized with insulin in the beta cells of pancreatic islets. Amylin regulates glucose homeostasis by inhibiting gastric emptying, inhibiting the release of the counter-regulatory hormone glucagon and inducing meal-ending satiety. Amylin functions as a glucoregulatory and satiety-inducing hormone, which is protective against postprandial spikes in blood glucose and overeating.[1]
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 124447-81-0
-
Appearance Solid
-
Molecular Weight 3920.44
-
Formula C167H272N52O53S2
-
Color White to off-white
-
Synonyms
Amylin (rat)
-
Sequence
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7)
-
Sequence Shortening
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
Solvent & Solubility
H2O : 100 mg/mL (25.51 mM; Need ultrasonic)
DMSO : 50 mg/mL (12.75 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (285 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO / H2O | 1 mM | 0.2551 mL | 1.2754 mL | 2.5507 mL | 6.3768 mL |
| 5 mM | 0.0510 mL | 0.2551 mL | 0.5101 mL | 1.2754 mL | |
| 10 mM | 0.0255 mL | 0.1275 mL | 0.2551 mL | 0.6377 mL | |
| H2O | 15 mM | 0.0170 mL | 0.0850 mL | 0.1700 mL | 0.4251 mL |
| 20 mM | 0.0128 mL | 0.0638 mL | 0.1275 mL | 0.3188 mL | |
| 25 mM | 0.0102 mL | 0.0510 mL | 0.1020 mL | 0.2551 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Amylin, amide, rat Related Classifications
HY-P1464 Related Classifications
Powered by Bioz