2. GPCR/G Protein
  3. GCGR
  4. GLP-1(7-37) acetate

GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-1(7-37) acetate Chemical Structure

GLP-1(7-37) acetate Chemical Structure

CAS No. : 1450806-98-0

Size Price Stock Quantity
1 mg USD 140 In-stock
5 mg USD 280 In-stock
10 mg USD 420 In-stock
25 mg USD 820 In-stock
50 mg USD 1250 In-stock
100 mg USD 1870 In-stock
200 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 3 publication(s) in Google Scholar

Other Forms of GLP-1(7-37) acetate:

GLP-1(7-37) acetate Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion[1].

In Vivo

GLP-1(7-37) (0.5, 5 or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion in rats[2].
Infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 hour through 7 hours produces a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle in rats with maintained glucose concentration at 11 mM[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male Sprague-Dawley rats weighing 300 to 350 g with glucose IV at a variable rate for 7 hours to maintain plasma glucose concentration at 11 mM[2].
Dosage: 5 pmol/min/kg.
Administration: IV from 1 hour through 7 hours[2].
Result: Produced a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle.
Animal Model: Male Sprague-Dawley rats weighing 300 to 350 g with maintained plasma glucose concentration at 11 mM[2].
Dosage: 0.5, 5 or 50 pmol/min/kg.
Administration: IV during the second hour of a 2-hour 11-mmol/L hyperglycemic clamp.
Result: Produced a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion.
Molecular Weight

3415.72

Formula

C153H232N40O49
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
Sequence Shortening

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

H2O : 50 mg/mL (14.64 mM; ultrasonic and adjust pH to 1 with HCl)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2928 mL 1.4638 mL 2.9276 mL
5 mM 0.0586 mL 0.2928 mL 0.5855 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo:

For the following dissolution methods, please prepare the working solution directly. It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

  • Protocol 1

    Add each solvent one by one:  PBS

    Solubility: 12.5 mg/mL (3.66 mM); Clear solution; Need ultrasonic

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2928 mL 1.4638 mL 2.9276 mL 7.3191 mL
5 mM 0.0586 mL 0.2928 mL 0.5855 mL 1.4638 mL
10 mM 0.0293 mL 0.1464 mL 0.2928 mL 0.7319 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

GLP-1(7-37) acetate Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

GLP-1(7-37)1450806-98-0GCGRGlucagon ReceptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-1(7-37) acetate
Cat. No.:
HY-P0055A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.