1. GPCR/G Protein
  2. Glucagon Receptor
  3. GLP-1(7-37) acetate

GLP-1(7-37) acetate 

Cat. No.: HY-P0055A Purity: 98.65%
Handling Instructions

GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

For research use only. We do not sell to patients.

GLP-1(7-37) acetate Chemical Structure

GLP-1(7-37) acetate Chemical Structure

CAS No. : 1450806-98-0

Size Price Stock Quantity
1 mg USD 252 In-stock
Estimated Time of Arrival: December 31
5 mg USD 432 In-stock
Estimated Time of Arrival: December 31
10 mg USD 660 In-stock
Estimated Time of Arrival: December 31
25 mg USD 1080 In-stock
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of GLP-1(7-37) acetate:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion[1].

In Vivo

GLP-1(7-37) (0.5, 5 or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion in rats[2].
Infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 hour through 7 hours produces a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle in rats with maintained glucose concentration at 11 mM[2].

Animal Model: Male Sprague-Dawley rats weighing 300 to 350 g with glucose IV at a variable rate for 7 hours to maintain plasma glucose concentration at 11 mM[2].
Dosage: 5 pmol/min/kg.
Administration: IV from 1 hour through 7 hours[2].
Result: Produced a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle.
Animal Model: Male Sprague-Dawley rats weighing 300 to 350 g with maintained plasma glucose concentration at 11 mM[2].
Dosage: 0.5, 5 or 50 pmol/min/kg.
Administration: IV during the second hour of a 2-hour 11-mmol/L hyperglycemic clamp.
Result: Produced a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion.
Molecular Weight

3415.72

Formula

C₁₅₃H₂₃₂N₄₀O₄₉

CAS No.

1450806-98-0

Sequence

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Sequence Shortening

HAEGTFTSDVSSYLEGQAAKEFIAWLVKG-R-G

SMILES

OC(C)=O.[HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG]

Shipping

Room temperature in continental US; may vary elsewhere

Storage
Protect from light
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-1(7-37) acetate
Cat. No.:
HY-P0055A
Quantity: