1. GPCR/G Protein
  2. Glucagon Receptor

GLP-1(7-37) (Synonyms: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG)

Cat. No.: HY-P0055 Purity: 98.62%
Handling Instructions

GLP-1(7-37) is an insulinotropic peptide generated from the precursor peptide GLP-1(1-37).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-1(7-37) Chemical Structure

GLP-1(7-37) Chemical Structure

CAS No. : 106612-94-6

Size Price Stock Quantity
1 mg USD 252 In-stock
Stock in Sweden
Estimated Time of Arrival: December 31
5 mg USD 432 In-stock
Stock in Sweden
Estimated Time of Arrival: December 31
10 mg USD 660 In-stock
Stock in Sweden
Estimated Time of Arrival: December 31
25 mg USD 1080 In-stock
Stock in Sweden
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References

Description

GLP-1(7-37) is an insulinotropic peptide generated from the precursor peptide GLP-1(1-37). target: GLP-1 receptor IC50:0.31 ± 0.01nM(Binding experiments with RIN T3 membranes) EC50:0.9 ± 0.1nM(RIN T3 cells cyclic AMP Production) [1] In vitro: After ingestion of a meal, the truncated bioactive sequences GLP-1(7-37) is secreted by the L cells of the intestinal mucosa.it has EC50 of 0.9 ± 0.1nM when test the RIN T3 cells cyclic AMP production;Besides,it has IC50 of 0.31 ± 0.01nM for the binding experiments with RIN T3 membranes.

References
Preparing Stock Solutions
Concentration Volume Mass 1 mg 5 mg 10 mg
1 mM 0.2980 mL 1.4900 mL 2.9800 mL
5 mM 0.0596 mL 0.2980 mL 0.5960 mL
10 mM 0.0298 mL 0.1490 mL 0.2980 mL
Please refer to the solubility information to select the appropriate solvent.
References
Molecular Weight

3355.67

Formula

C₁₅₁H₂₂₈N₄₀O₄₇

CAS No.

106612-94-6

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Shipping

Room temperature in continental US; may vary elsewhere

Solvent & Solubility

H2O: 30 mg/mL

* "<1 mg/mL" means slightly soluble or insoluble. "≥" means soluble, but saturation unknown.

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-1(7-37)
Cat. No.:
HY-P0055
Quantity: