1. Recombinant Proteins
  2. Others
  3. Apolipoprotein E/APOE Protein, Mouse (HEK293, His)

Apolipoprotein E/APOE Protein, Mouse (HEK293, His)

Cat. No.: HY-P7532
COA Handling Instructions

Apolipoprotein E Protein, Mouse (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E regulates tight junction (TJs) function by regulating PKCη activity and phosphorylation of occludin on its Thr residues in an isoform-dependent manner. Apolipoprotein E also promotes cholesterol release.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg $85 In-stock
10 μg $140 In-stock
50 μg $400 In-stock
100 μg $650 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Apolipoprotein E Protein, Mouse (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein E regulates tight junction (TJs) function by regulating PKCη activity and phosphorylation of occludin on its Thr residues in an isoform-dependent manner. Apolipoprotein E also promotes cholesterol release[1][2].

Background

ApoE isoform specifically inhibits lipid-particle-mediated cholesterol release from neurons. Although apoE and a lipid particle are lipid acceptors, when apoE and a lipid particle form a complex, apoE on the particle surface inhibits the lipid particle-mediated cholesterol release from cells in an apoE-concentration-dependent manner[2].

Biological Activity

Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 this effect is ≤41.72 ng/ml, corresponding to a specific activity is ≥2.39×10^4 units/mg.

  • Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 for this effect is 41.72 ng/ml, corresponding to a specific activity is 2.39×104 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P08226 (E19-Q311)

Gene ID
Molecular Construction
N-term
APOE (E19-Q311)
Accession # P08226
6*His
C-term
Synonyms
rMuApolipoprotein E, His; ApoE; Apolipoprotein E
AA Sequence

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQHHHHHH

Molecular Weight

Approximately 34-40 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Apolipoprotein E/APOE Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7532
Quantity:
MCE Japan Authorized Agent: