Copy Link Print Information

Apolipoprotein E/APOE Protein, Mouse (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Apolipoprotein E/APOE is a key molecule linking lipid metabolism and neurological function. Apolipoprotein E/APOE gene polymorphisms are closely associated with diseases such as Alzheimer’s disease and atherosclerosis by influencing protein structure and function. Apolipoprotein E/APOE Protein, Mouse (HEK293, His) is a recombinant APOE protein expressed in HEK293 cells, with a C-6*His tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Apolipoprotein E/APOE Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Apolipoprotein E/APOE is a key molecule linking lipid metabolism and neurological function. Apolipoprotein E/APOE gene polymorphisms are closely associated with diseases such as Alzheimer’s disease and atherosclerosis by influencing protein structure and function. Apolipoprotein E/APOE Protein, Mouse (HEK293, His) is a recombinant APOE protein expressed in HEK293 cells, with a C-6*His tag[1][2][3].

Background

Apolipoprotein E/APOE is a member of the soluble apolipoprotein family, primarily synthesized in the liver and brain. Liver-derived Apolipoprotein E/APOE participates in peripheral lipid metabolism, while brain-derived Apolipoprotein E/APOE, produced by astrocytes, is involved in neuronal repair and synaptic plasticity. Apolipoprotein E/APOE plays a critical role in lipid transport within both plasma and the central nervous system by interacting with the low-density lipoprotein receptor family. The three common Apolipoprotein E/APOE isoforms (APOE2, APOE3, APOE4), differing in amino acids at positions 112 and 158, have distinct effects on the risk of diseases such as atherosclerosis and Alzheimer’s disease. Due to domain interactions and lower stability, APOE4 is a major genetic risk factor for Alzheimer’s disease, while APOE2 is associated with type III hyperlipoproteinemia due to weak receptor binding[1][2][3].

Verified Bioactivity

1.Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 this effect is 15-50 ng/mL.
2.Mouse TREM-2 immobilized on CM5 Chip can bind Mouse APOE with an affinity constant of 3.595 nM as determined in a SPR assay.
3.Immobilized Recombinant Mouse ApoE (C-6His) at 2 μg/ml (100 μl/well) can bind Recombinant Human TREM2 (C-Fc). The ED50 of Recombinant Human TREM2 (C-Fc) is 8.05-34.77 ng/ml.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 for this effect is 41.72 ng/mL, corresponding to a specific activity is 2.39×104 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    P08226 (E19-Q311)

  • Gene ID
    11816  [NCBI]
  • Molecular Construction
    • N-term
    • APOE (E19-Q311)
      Accession # P08226
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    APOE; Apolipoprotein E3; Prev. AD2; APO-E; Alzheimer Disease 2 (APOE*E4-Associated, Late Onset); ApoE4; Apolipoprotein E Isoform 4; Apo-E; Apolipoprotein E Isoform 5; LPG; Apolipoprotein E Isoform 2; Apolipoprotein E; LDLCQ5

  • AA Sequence

    EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

  • Molecular Weight

    Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Gong JS, et al. Novel action of apolipoprotein E (ApoE): ApoE isoform specifically inhibits lipid-particle-mediated cholesterol release from neurons. Mol Neurodegener. 2007 May 15;2:9. [Content Brief]

[2]. Hatters DM, et al. Apolipoprotein E structure: insights into function. Trends Biochem Sci. 2006 Aug;31(8):445-54.

[3]. Eichner JE, et al. Apolipoprotein E polymorphism and cardiovascular disease: a HuGE review. Am J Epidemiol. 2002 Mar 15;155(6):487-95. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using SH-SY5Y Human neuroblastoma cells. The ED50 for this effect is 41.72 ng/mL, corresponding to a specific activity is 2.39×104 units/mg.

  • 1/16

    Apolipoprotein E/APOE Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Res. 2025 Aug 1;85(15):2805-2819. [Abstract]

    Customer Validation
     Different concentrations of Apolipoprotein E/APOE Protein caused changes in CXCR4 expression levels in TipECs in mice after 48 hours.

  • 1/16

    Apolipoprotein E/APOE Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Res. 2025 Aug 1;85(15):2805-2819. [Abstract]

    Customer Validation
     Immunofluorescence staining showed that Apolipoprotein E/APOE Protein, Mouse (10 ng/mL) induced increased expression of CXCR4 and SCARB1 in HUVECs after 48 hours.

  • 1/16

    Apolipoprotein E/APOE Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Res. 2025 Aug 1;85(15):2805-2819. [Abstract]

    Customer Validation
     Apolipoprotein E/APOE Protein, Mouse (10 μg) or an equal volume of PBS was administered via gastric instillation, and IHC staining was used to visualize the number of tumor stromal cells.

  • 1/16

    Apolipoprotein E/APOE Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cancer Res. 2025 Aug 1;85(15):2805-2819. [Abstract]

    Customer Validation
     Effects of Apolipoprotein E/APOE Protein, Mouse (10 ng/mL) on transcription factor activity at different time points.

  • Apolipoprotein E/APOE Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Apolipoprotein E/APOE Protein, Mouse (HEK293, His)
  • Apolipoprotein E/APOE Protein, Mouse (HEK293, His) Product Image